KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM1727Help
Entry
STM1727           CDS       T00065                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00260  Glycine, serine and threonine metabolism
stm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01130  Biosynthesis of antibiotics
stm01230  Biosynthesis of amino acids
Module
stm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STM1727 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STM1727 (trpA)
Enzymes [BR:stm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STM1727 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO NanE
Motif
Other DBs
NCBI-GeneID: 1253246
NCBI-ProteinID: NP_460686
UniProt: P00929
Structure
PDB: 

Jmol
Position
1824266..1825072
Genome map
AA seq 268 aa AA seqDB search
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD
GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS
GVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKI
IEKNLASPKQMLAELRSFVSAMKAASRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaaaatttatttgcccaactcaacgatcgccgggaaggcgcttttgtc
cccttcgtgaccctgggcgaccctggcattgaacagtcactgaaaattattgacacactg
attgacgctggcgccgacgctctggaactgggggttcccttctccgatccgctggccgat
ggccctaccatccagaatgcgaacttacgcgccttcgccgctggcgtcacgccggctcag
tgttttgaaatgctggcgctgattcgtgaaaaacacccgaccattccgattggcctgcta
atgtacgcgaatctggtgttcaataacggcatagatgcgttctatgcccgttgtgaacag
gttggcgtagattccgtgctggtcgcagatgtcccggttgaagaatcggcccccttccgc
caggcagcgttacggcataatatcgcgccgatcttcatctgcccgccaaatgcggatgac
gatcttctgcgccaggtcgcatcttacggccgcggttacacctacctgctttcgcgttcg
ggtgtcaccggcgcggaaaaccgtggcgcattgccgttgcatcatctcattgagaagctt
aaagagtaccatgccgcgcctgcgttacagggcttcggtatctcctcgccggaacaggtg
tctgcggccgtgcgtgccggggcggctggcgctatctccggctcagccattgtcaagatt
atcgagaaaaacctcgcgtctcccaaacagatgttggcggagctcaggtcctttgtctca
gccatgaaagccgccagccgcgcataa

DBGET integrated database retrieval system