KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2098Help
Entry
STM2098           CDS       T00065                                 

Gene name
galF
Definition
(RefSeq) GalU regulator GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00040  Pentose and glucuronate interconversions
stm00052  Galactose metabolism
stm00500  Starch and sucrose metabolism
stm00520  Amino sugar and nucleotide sugar metabolism
stm01100  Metabolic pathways
stm01130  Biosynthesis of antibiotics
Module
stm_M00362  Nucleotide sugar biosynthesis, prokaryotes
stm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STM2098 (galF)
   00052 Galactose metabolism
    STM2098 (galF)
   00500 Starch and sucrose metabolism
    STM2098 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    STM2098 (galF)
Enzymes [BR:stm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STM2098 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-GeneID: 1253619
NCBI-ProteinID: NP_461043
UniProt: P0A2K7
Position
complement(2178954..2179847)
Genome map
AA seq 297 aa AA seqDB search
MMNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDDATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatgttgcctgcc
accaaggcaatcccaaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gtcgatgagattgtggctgcagggatcaaagaaatcgtgctggtgactcacgcgtctaaa
aacgccgttgagaaccacttcgacacctcttatgaacttgaatcacttcttgagcagcgc
gttaagcgtcagcttttggcggaagtgcaatctatctgcccaccgggcgtgacgattatg
aacgttcgccaggcgcagccgttagggctggggcattctattctgtgcgcgcgtccggtc
gtgggcgataaccctttcattgtggtactcccggatattattatcgatgatgctaccgcc
gatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacgggtcgcagc
caggtgctggcgaagcgcatgaaaggtgatttatcggagtattccgttatccagacgaaa
gaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaaaaaccggat
cagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctttcagccgac
atctgggcggaactggaaagaaccgaaccgggcgcctggggccgcatccagctcaccgat
gccattgctgaactggcgaaaaaacagtcggttgacgcgatgctaatgacgggtgacagc
tatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacgggctgcgcaac
ctgaaagaaggagccaagttccgtaagagcatagagcagcttttgcatgaataa

DBGET integrated database retrieval system