KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2226Help
Entry
STM2226           CDS       T00065                                 

Gene name
yejK
Definition
nucleoid-associated protein
Orthology
K06899  
nucleoid-associated protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2327474..2328481)
Genome map
AA seq 335 aa AA seqDB search
MSLDINQIALHQLIKRDEQNLELVLRDSLLEPTTTVVEMVAELHRVYSAKNKAYGLFNEE
SELAQALRLQRQGEEDFLAFSRAATGRLRDELAKYPFADGGIVLFCHYRYLAVEYLLVTV
LNNLSSMRVNENLDINPTHYLDINHADIVARIDLTEWETNPQSTRYLTFLKGRVGRKVAD
FFMDFLGASEGLNAKAQNRGLLQAVDDFTAEAQLDKAERQNVRQQVYSYCNEQLQAGEEI
ELESLSKELSGVSEVSFSEFTAEKGYELEESFPADRSTLRQLTKYAGSGGGLTINFDAML
LGERIFWDPATDTLTIKGTPPNLRDQLQRRTSGGK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtctggatatcaaccagattgccctgcaccagcttatcaagcgcgatgagcaaaat
cttgagctggtcttgcgcgattcattgctggagccgacaaccaccgttgtcgagatggtg
gctgaactgcatcgggtctatagcgccaagaataaggcgtatggcctgtttaatgaagag
agtgaactggcgcaagcgctgcggttgcaacgtcagggggaagaagattttcttgccttt
agccgggcggcgaccggacgcctgcgtgacgaactggcgaaatatccctttgcggacggc
ggcattgtattgttctgccattatcgttacctggcggtggagtatctgctggttacggta
ctgaacaacctgagtagtatgcgggtcaatgaaaatctggacattaacccgacgcattat
cttgatatcaaccatgcggatatcgtggcgcgtatcgatcttaccgagtgggaaactaat
ccgcaatcgacccgctatctgacgtttctcaaaggtcgggtagggcgcaaggtcgctgac
ttctttatggatttcctcggcgccagcgaagggttgaacgccaaagcgcagaatcgcggc
ctgttgcaggcagtggatgatttcaccgcagaagcgcagttggataaagcggaacgtcag
aacgtgcgccagcaggtgtacagctactgcaatgagcaattacaagccggggaagaaatt
gagctggaatcgctgtctaaagagctttccggcgtcagtgaagtcagcttcagcgaattt
accgccgaaaaaggctatgagctggaagagagcttcccggcagatcgcagtacgctacgc
cagttaaccaaatatgccggcagcggcggcgggttaacgattaactttgatgcgatgcta
ctgggcgagcggattttctgggacccggcgaccgataccctgactatcaaagggacgccg
ccgaatttgcgcgatcagttgcagcgacgcacgtcgggcgggaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system