KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2324Help
Entry
STM2324           CDS       T00065                                 

Gene name
nuoF
Definition
(RefSeq) NADH-quinone oxidoreductase subunit F
  KO
K00335  
NADH-quinone oxidoreductase subunit F [EC:1.6.5.3]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    STM2324 (nuoF)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     STM2324 (nuoF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2434650..2435987)
Genome map
AA seq 445 aa AA seqDB search
MKNVIRTPETHPLTWRLRDDKQPVWLDEYRSKNGYEGARKALTGLSPDEIVSQVKDAGLK
GRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISA
FALKAYRGYIFLRGEYIEAAVHLRRAIAEATEAGLLGKNIMGTGFDFELFVHTGAGRYIC
GEETALINSLEGRRANPRSKPPFPATSGVWGKPTCVNNVETLCNVPAILANGVEWYQNIS
KSKDAGTKLMGFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGAGTDFL
TEAHLDLPMEFESIGKAGSRLGTALAMAVDHEIGMVSLVRNLEEFFARESCGWCTPCRDG
LPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAHAPGAVEPLQSAIKYFREEFE
AGIKQPFSNTHLINGIQPNLLKERW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgttatccgtactcccgaaacccatccgctgacctggcgtctgcgcgatgac
aaacagccggtctggctggatgaatatcgtagcaaaaacggctacgaaggcgcgcgtaag
gcgctgaccggcctgtctccggatgaaatcgtcagccaggtaaaagacgccggtctgaaa
gggcgcggcggcgcgggcttttccaccggtctgaagtggagcctgatgccgaaagatgaa
tccatgaacatccgttacctgctgtgtaacgccgatgaaatggaaccgggcacctataaa
gaccgtctgctgatggaacaactgccgcacctgctggtggaaggtatgttgatctccgcg
ttcgcgctgaaagcgtatcgtggttacatcttcctgcgcggcgaatatatcgaagcggct
gtacatctgcgccgtgcgattgccgaagcaaccgaggccgggctgcttggcaaaaatatc
atgggcaccgggttcgactttgaactgtttgtccacaccggggcagggcgttacatctgt
ggtgaagaaacggcgctgattaactccctcgaaggccgccgcgcgaacccgcgctccaag
ccgcctttcccggcgacctccggcgtatggggcaagccgacctgtgtgaataacgtcgaa
acgttgtgtaacgtcccggcaatcctcgccaacggcgtggagtggtaccagaacatctcg
aaaagcaaagatgcgggtaccaagctgatgggcttctcgggccgcgtgaagaatccgggc
ctgtgggaattaccgttcggcaccaccgcgcgcgagatcctcgaagactacgccggcggt
atgcgcgatggcctgaaattcaaagcctggcagccgggcggggcgggaaccgacttcctg
accgaggcgcatcttgacctgccgatggagttcgaaagcatcggtaaagcaggcagccgt
ctgggcaccgcgctggcgatggcggtagaccacgaaatcggcatggtgtcgctggtgcgt
aacctggaagagttctttgcccgcgaatcctgcggctggtgtacgccatgccgcgacggg
ctgccgtggagcgtgaaaattctgcgcgcgctggagcgtggcgaaggccagccgggggat
atcgagacacttgagcaactgtgtcgtttcctcggaccgggtaaaaccttctgcgcgcat
gcgccgggcgcggttgagccactgcaaagcgcaattaagtatttccgcgaagaattcgaa
gctggcatcaagcagccgttcagtaatacccatttaatcaatggtattcagccgaacctg
ctcaaagagcgctggtga

DBGET integrated database retrieval system