KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2326Help
Entry
STM2326           CDS       T00065                                 

Gene name
nuoC
Definition
(RefSeq) NADH-quinone oxidoreductase subunit C/D
  KO
K13378  NADH-quinone oxidoreductase subunit C/D [EC:1.6.5.3]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00190  Oxidative phosphorylation
stm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    STM2326 (nuoC)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     STM2326 (nuoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_49kDa Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 1253848
NCBI-ProteinID: NP_461268
UniProt: P0A1Y6
Position
complement(2436487..2438289)
Genome map
AA seq 600 aa AA seqDB search
MVNNMTDLTAQDAAWSTRDHLDDPVIGELRNRFGPDAFTVQATRTGIPVVWVKREQLLEV
GDFLKKLPKPYVMLFDLHGMDERLRTHRDGLPAADFSVFYHLISIERNRDIMLKVALSEN
DLRVPTFTKLFPNANWYERETWEMFGIDIEGHPHLTRIMMPQTWEGHPLRKDYPARATEF
DPFELTKAKQDLEMEALTFKPEDWGMKRGTDNEDFMFLNLGPNHPSAHGAFRIILQLDGE
EIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNEMPYVLAVEKLAGITVP
DRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQKIYDLVEAITGFRMHP
AWFRIGGVAHDLPRGWDRLLREFLEWMPKRLDSYEKAALRNTILKGRSQGVAAYGAKEAL
EWGTTGAGLRATGIDFDVRKWRPYSGYENFDFEVPVGGGVSDCYTRVMLKVEELRQSLRI
LQQCLDNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVSWGPVMPAQESFQMVEAT
KGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPSAIRGSLVSDLIVYLGSIDFVMSDVDR
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacaatatgaccgacttaaccgcgcaagacgctgcatggagtacccgcgatcat
cttgatgatccggttatcggcgaactgcgcaaccgttttgggccggatgcctttaccgtt
caggcgacccgcaccggtatccccgttgtttgggtcaagcgtgaacaactactggaggtt
ggcgatttcttaaagaaactgccgaaaccttacgtcatgctgtttgacttacacggcatg
gatgaacgcctgcgtacgcaccgtgacgggttacccgccgcggatttttccgttttctac
cacctgatttccattgagcgtaatcgcgatatcatgctcaaggtggcgttgtctgaaaac
gacctgcgcgtgccgaccttcactaaacttttccctaacgccaactggtacgagcgtgag
acctgggagatgtttggtattgatatcgaaggccacccgcacctgacgcgcatcatgatg
ccgcaaacctgggaaggccatccgctgcgtaaagattatccggcgcgcgcgaccgaattc
gacccgtttgagctgaccaaagccaagcaggatctggaaatggaagcgctgacctttaag
ccggaagactgggggatgaagcgcgggactgacaacgaggactttatgttcctcaacctc
ggcccgaaccacccgtctgcgcacggtgcgtttcgtattatcctgcaacttgacggtgaa
gaaatcgtcgactgcgtgccggatatcggctatcaccaccgcggcgccgaaaaaatgggc
gagcgccagtcctggcatagctacattccctataccgaccgtatcgaatacctcggtggt
tgcgtcaatgaaatgccgtacgtgctggcggtagaaaagttggcagggatcaccgtcccg
gatcgtgtgaacgtcatccgcgtgatgctctccgaactgttccgcattaacagtcatctg
ctgtacatctcgacctttattcaggacgtcggcgcgatgacgccggtcttctttgccttt
accgaccggcagaaaatttatgacctggtggaagccattaccggtttccgtatgcacccg
gcctggttccgtatcggcggcgtcgcgcacgacttgccgcgcggttgggatcgcctgctg
cgagagttccttgagtggatgccgaagcgtctggattcttacgagaaagccgcgctgcgt
aacactattctgaaagggcgttcgcagggcgttgccgcttacggcgcgaaagaggcgctg
gagtggggcaccaccggcgcagggctgcgcgcgaccgggatcgacttcgacgtacgtaaa
tggcgtccatactctggctacgaaaactttgactttgaagtgccggtgggtggcggcgtt
tccgactgctatacccgcgtgatgctgaaagtggaagagctgcgccagagtctgcgcatt
cttcagcagtgcctcgataacatgccggaaggcccgttcaaagcggatcacccgctgacc
acgccgccgccgaaagagcgcacgctgcaacatatcgaaaccctgatcacccacttcctg
caggtctcctggggcccggtgatgccggcgcaggagtccttccagatggtggaagcgacg
aaggggattaacagttactacctgaccagcgacggcagcactatgagctaccgtacccgc
gtgcgcacgccgagctttgcgcacttgcagcagattccctcggcgatccgcggtagcctg
gtctccgacctgattgtctatctgggtagtatcgattttgttatgtcagatgtggaccgc
taa

DBGET integrated database retrieval system