KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2329Help
Entry
STM2329           CDS       T00065                                 

Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1253851
NCBI-ProteinID: NP_461271
UniProt: Q7CQ48
Position
complement(2439892..2440044)
Genome map
AA seq 50 aa AA seqDB search
MPICTRLTAQIVKVAVNQPVAIRSSMWAKNNQNIHFMNLHVKKLEKLLLF
NT seq 153 nt NT seq  +upstreamnt  +downstreamnt
gtgcccatctgtacgcgcttaaccgcacaaattgtaaaagttgcggtaaatcagccagta
gcgattcgcagttcaatgtgggcaaaaaataaccagaacatccattttatgaatttgcat
gttaaaaaactagagaaattgttgctgttttag

DBGET integrated database retrieval system