KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2330Help
Entry
STM2330           CDS       T00065                                 

Gene name
lrhA
Definition
(RefSeq) transcriptional regulator LrhA
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-GeneID: 1253852
NCBI-ProteinID: NP_461272
UniProt: Q8ZNE1
Position
complement(2440124..2441062)
Genome map
AA seq 312 aa AA seqDB search
MINANRPIINLDLDLLRTFVAVADLNTFAAAAAAVCRTQSAVSQQMQRLEQLVGKELFAR
HGRNKLLTEHGIQLLGYARKILRFNDEACSSLMFSNLQGVLTIGASDESADTILPFLLSR
ISSVYPKLALDVRVKRNAYMVDMVKSQEVDLVVTTNQPHSLDCLNLRTSPTHWYCAAEYV
LQRGEPVPLVLLDDPSPFRDMVLETLNAAGIPWRLAYVASTLPAVRAAVKAGLGVTARPV
EMMSPDLRVLGAADGLPPLPDTEYLLCRDPNSQNELAMVIFHAMESYQNPWHYNQFSAEG
GDDPLMVEGGFE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgcaaatcgtccgataattaacctcgatctcgatctgctgagaacgttcgtg
gccgttgccgatctgaacaccttcgccgcggcggcggcggcggtatgtcgtactcagtct
gcggtcagtcagcaaatgcagcgtcttgagcaactcgtgggaaaggaattgttcgcccgc
catggccgtaacaaacttttgaccgaacacggtatccagcttctggggtacgccagaaaa
atcctgcgttttaatgatgaggcgtgttcatcattaatgttcagtaatcttcagggagtg
ttaacaatcggcgcttctgatgaatcagctgatactatcctgccttttttgcttagccga
atcagctcggtttatccgaaactcgcgcttgatgtacgggtaaaacgcaacgcctatatg
gtggacatggttaaatcgcaggaagtagatttggtggtgacgactaaccaacctcattcg
ctggactgtctgaatttgcggacctcgcccacccattggtattgtgcggctgagtatgtt
ttgcaaaggggagagcccgtaccactagtcctgctggacgatcccagcccattccgcgat
atggtgctggagacgctaaatgcagcgggtattccctggcggctggcctatgtggcgtct
acattaccggcggtacgcgcggccgttaaagccggtcttggcgtaacggctcgacctgtc
gaaatgatgagtcccgaccttcgcgtgctgggcgccgcagacggattaccgcctttgccg
gatacggaatatctgttgtgccgcgatcccaatagccagaacgagctggcgatggtgatt
ttccatgcgatggaaagctaccaaaacccatggcattacaaccagttttctgcagagggc
ggagatgatccgctgatggtggaagggggttttgagtag

DBGET integrated database retrieval system