KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2368Help
Entry
STM2368           CDS       T00065                                 

Gene name
truA
Definition
(RefSeq) tRNA pseudouridine(38-40) synthase TruA
  KO
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
Enzymes [BR:stm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     STM2368 (truA)
Transfer RNA biogenesis [BR:stm03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    STM2368 (truA)
 Prokaryotic Type
    STM2368 (truA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2480461..2481273)
Genome map
AA seq 270 aa AA seqDB search
MSGQQSSAVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPINVFCAGRTD
AGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRY
IIYNHRLRPAVLAKGVTHYYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMH
INVTRHGPYVVVDIKANAFVHHMVRNIVGSLLEVGAHNQPESWIAELLAARDRTLAAATA
KAEGLYLVAVDYPDRFDLPKPPMGPLFLAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtccggacagcaatcatcggcggtctataaaattgcgctgggtattgagtacgacggc
agcaagtattatggctggcagcgtcagaatgaagtgcgcagcgtgcaggaaaagctggaa
aaagcgctctcgcaggtggcaaatgaacctattaacgtgttctgcgccgggcgtaccgat
gccggcgttcacggcaccgggcaggttgtccatttcgaaacgaccgcattgcgcaaagat
gcggcatggacgctgggggtaaatgcgaatttgcctggtgacattgccgtgcgctgggtg
aaaactgtaccggatgattttcacgcgcgatttagcgctacggctcgccgttatcgctat
atcatctacaatcatcgactgcgtcctgcggtattagcaaaaggcgtgacgcattactat
gagccgctggatgcagagcggatgcatcgcgcggcgcagtgtctgcttggcgaaaatgat
tttacctcgtttcgcgcagtgcagtgccagtcgcgcacgccgtggcgtaatgtgatgcac
atcaacgttacccgccacggcccttatgtggtggtcgatatcaaagcgaatgcctttgtt
catcatatggtcaggaatattgtcggcagcctgctggaagtaggcgctcacaaccagccg
gagagctggatcgcagagctgttagcggccagggacagaacgctggcggcggcaacggcg
aaggcggaagggctatatttggttgcggtggattaccctgaccggtttgaccttccaaaa
ccgccaatgggcccgctatttctggcggactaa

DBGET integrated database retrieval system