KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2370Help
Entry
STM2370           CDS       T00065                                 

Gene name
pdxB
Definition
(RefSeq) 4-phosphoerythronate dehydrogenase PdxB
  KO
K03473  erythronate-4-phosphate dehydrogenase [EC:1.1.1.290]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00750  Vitamin B6 metabolism
stm01100  Metabolic pathways
Module
stm_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STM2370 (pdxB)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.290  4-phosphoerythronate dehydrogenase
     STM2370 (pdxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C DUF3410 2-Hacid_dh
Motif
Other DBs
NCBI-GeneID: 1253892
NCBI-ProteinID: NP_461312
UniProt: P60802
Structure
PDB: 

Jmol
Position
complement(2482354..2483490)
Genome map
AA seq 378 aa AA seqDB search
MKILVDENMPYARELFSRLGEVKAVPGRPIPVEELNHADALMVRSVTKVNESLLSGTPIN
FVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSALLMLAERDGFSLRDRTIG
IVGVGNVGSRLQTRLEALGIRTLLCDPPRAARGDEGDFRTLDELVQEADVLTFHTPLYKD
GPYKTLHLADETLIRRLKPGAILINACRGPVVDNAALLARLNAGQPLSVVLDVWEGEPDL
NVALLEAVDIGTSHIAGYTLEGKARGTTQVFEAYSAFIGREQRVALETLLPAPEFGRITL
HGPLDQPTLKRLAHLVYDVRRDDAPLRKVAGIPGEFDKLRKNYLERREWSSLYVMCDDET
AAALLCKLGFNAVHHPAH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattctcgttgatgaaaatatgccttacgcccgcgaattatttagccgcctgggt
gaggtaaaggcagtgccgggtcgcccgatccccgttgaagaattgaaccatgccgatgcg
ttaatggtgcgttcggtcacgaaagtgaatgaatcgctgctgagcggcacgccgattaac
ttcgttggtactgctacggcaggcaccgatcatgtggatgaggcatggctgaagcaggcg
ggcatcggtttttcagccgcgcccggctgtaatgctatcgccgtggtggagtatgtgttt
tccgcgctgttgatgctggccgaacgtgacggcttttcgttacgcgatcgcactataggg
attgtcggcgtgggtaacgtcggaagccggctacagaccaggcttgaagcgttgggtatc
cgcacgttgctgtgcgatccgccacgcgccgcacgcggggacgagggtgattttcgtacg
ctggatgagctggtgcaggaagcggatgtcctgactttccatacgccgctctataaagac
ggaccgtacaaaacgctgcatctggccgatgagacgctgatccgtcgactgaaacccggc
gccattctcattaacgcctgccgcggtccggtggtggataacgccgcgttgctggcgcga
cttaatgccgggcagccgctgagcgtggtgcttgatgtgtgggagggcgaaccggatctt
aacgtcgcgctactggaagccgtggatatcggcacgtcgcatattgccggctatacgctg
gaaggcaaagcgcgcggcaccacccaggtctttgaggcgtatagcgcgtttatcggtcgc
gagcagcgtgtcgcgctggagacattactgcctgcgcctgagtttggtcgtattacgctt
catggcccgctggatcaaccgacgctgaaaagactggcgcatttggtgtatgatgtgcgc
cgcgacgatgcgccactgcgtaaagtcgctggaattccgggtgaatttgataaattgcgt
aaaaattatcttgagcgccgtgaatggtcgtctttatacgtgatgtgtgacgacgaaacg
gcagccgccttgctgtgtaagctaggttttaacgctgttcatcacccggcacattaa

DBGET integrated database retrieval system