KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2372Help
Entry
STM2372           CDS       T00065                                 

Definition
(RefSeq) arabinose transporter
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 1253894
NCBI-ProteinID: NP_461314
UniProt: Q8ZNB8
Position
complement(2484592..2485770)
Genome map
AA seq 392 aa AA seqDB search
MTAVSQKTTTPSANFSLFRIAFAVFLTYMTVGLPLPVIPLFVHHELGYSNTMVGIAVGIQ
FFATVLTRGYAGRLADQYGAKRSALQGMLACGLAGAAWLLAALLPVSAPVKFALLIVGRL
ILGFGESQLLTGTLTWGLGLVGPTRSGKVMSWNGMAIYGALAAGAPLGLLIHSHFGFAAL
AGTTMVLPLLAWAFNGTVRKVPAYTGERPSLWSVVGLIWKPGLGLALQGVGFAVIGTFIS
LYFVSNGWTMAGFTLTAFGGAFVLMRILFGWMPDRFGGVKVAVVSLLVETAGLLLLWLAP
TAWIALVGAALTGAGCSLIFPALGVEVVKRVPAQVRGTALGGYAAFQDISYGVTGPLAGM
LATSYGYPSVFLAGAISAVVGILVTILSFRRG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagttagccaaaaaacaacgaccccgtctgcgaatttttcgctgttccgcatc
gcctttgcggttttcctgacctatatgacggtcggcctgccgttacccgtcatcccgctt
tttgttcatcacgaactgggctatagcaatacgatggttgggatcgccgtgggcattcag
ttttttgcgacggtactgacgcgcggctatgccggacggctggcggatcaatatggcgct
aaacgatcggcgttacaggggatgcttgcctgcgggctggcgggcgccgcctggctcctg
gccgcgctgttgccggtttccgcgccagtaaaattcgcgctgcttattgtcgggcgtttg
atcctcggatttggcgaaagccagctgctgaccggaaccctgacctggggactggggctg
gttggcccaacgcgttccggtaaggtgatgtcgtggaacgggatggcgatttacggcgcg
ctggcggccggtgcgccgttgggcttgctgatccatagccactttggcttcgcggcgctg
gcggggacgacgatggttttaccgctgctggcctgggcattcaacggcaccgtgcgtaaa
gtgcctgcgtatacgggggagcgaccttcactgtggagcgtggtcgggcttatctggaaa
ccgggcctgggcctggcattgcagggcgtgggctttgccgtcatcggtacgtttatttca
ctttattttgtcagcaatggctggacgatggcgggattcaccctgaccgcgtttggcggt
gcgtttgtactgatgcgcatattgttcggttggatgccggaccgctttggcggcgtgaag
gtcgccgttgtctcattgctggttgagacggcagggttgctgctcttgtggctggcgccg
acggcctggatagcgctggtaggcgcggcgctcaccggggcagggtgttcactgattttc
ccggcgctgggcgtggaggttgtgaaacgcgtacctgcacaggtacgcggtacggcgctc
ggcggctacgccgcgtttcaggatatctcctacggcgttaccggcccgctggcgggcatg
ctggccacgtcatacggctatccttccgtattcctcgcgggagcgatctccgcggtggtt
ggcatcctggtgacgatattatcgttccggcgcggttaa

DBGET integrated database retrieval system