KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2374Help
Entry
STM2374           CDS       T00065                                 

Definition
(RefSeq) DNA-binding protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_35 HTH_3 HTH_26 HTH_Tnp_ISL3 HTH_AraC HTH_19 HTH_31 HTH_24 HTH_10 HTH_25
Motif
Other DBs
NCBI-GeneID: 1253896
NCBI-ProteinID: NP_461316
UniProt: Q8ZNB6
Position
2486497..2486745
Genome map
AA seq 82 aa AA seqDB search
MEPKSQDWHRADIKSALEKRGITLRDLSRQAGLSPDSLRNVFTRSWPRAERIIADALGIT
PKEIWPSRYDDMQIKNDADIAE
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaaaaagccaagactggcatcgtgcagatattaaaagtgcacttgaaaaaaga
ggtattacgctcagagatctttctcgtcaggccggtttatcacctgattcactgcgcaat
gtctttacccgttcctggccgagagctgaacggattattgcggacgcgctgggcatcacg
ccgaaagagatctggccgtcgcgctatgatgatatgcaaataaaaaatgatgccgatatc
gcagaataa

DBGET integrated database retrieval system