KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2385Help
Entry
STM2385           CDS       T00065                                 

Gene name
yfcB
Definition
(RefSeq) ribosomal protein L3 N(5)-glutamine methyltransferase
  KO
K07320  ribosomal protein L3 glutamine methyltransferase [EC:2.1.1.298]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
Enzymes [BR:stm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.298  ribosomal protein L3 N5-glutamine methyltransferase
     STM2385 (yfcB)
Ribosome biogenesis [BR:stm03009]
 Prokaryotic Type
  ribosomal protein modification factors
   STM2385 (yfcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 Methyltransf_25 PrmA Methyltransf_15 Met_10 Methyltransf_12 Cons_hypoth95 Methyltransf_18 UPF0020 Ubie_methyltran Methyltransf_11 Methyltransf_23 Methyltransf_2 N6_Mtase Methyltransf_4 Methyltransf_24 Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 1253907
NCBI-ProteinID: NP_461327
UniProt: P0A293
Position
complement(2495661..2496593)
Genome map
AA seq 310 aa AA seqDB search
MDKIFVDEAVSELHTIQDMLRWAVSRFSAANIWYGHGTDNPWDEAVQLVLPSLYLPLDIP
EDMRTARLTSSEKHRIVERVIRRINERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGEL
INNHFAGLISQQPKYILDMCTGSGCIAIACAYAFPDAEVDAVDISPDALAVAEHNIEEHG
LIHHVTPIRSDLFRDLPKVQYDLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGTDGLKL
TRRILGNAPDYLSDDGVLICEVGNSMVHLMEQYPDVPFTWLEFDNGGDGVFMLTKAQLLA
AREHFNIYKD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtggataaaattttcgtcgatgaagcagtaagtgaactgcataccattcaggacatgttg
cgctgggcggtaagccgctttagcgcggcgaatatctggtatggacacggtaccgataac
ccgtgggatgaagcggtacaactggtgttgccgtctctttatctgccgctggatattccg
gaagatatgcggaccgcgcggctgacgtccagcgaaaaacaccgcattgtcgagcgagtg
attcgtcgcattaacgagcgtatcccggtcgcctacctgaccaataaagcctggttctgc
ggccacgaattttatgtcgatgagcgcgtgctggtgccgcgttcaccgattggcgagctg
attaataaccacttcgctggccttattagccaacagccgaaatatattctggatatgtgt
accggcagcggctgcatcgccatcgcctgtgcttatgctttcccggacgcagaggttgat
gcggtcgatatttcgccggatgcgctggctgtcgccgagcataacattgaagaacacggt
cttatccatcacgtgacgccaatccgttccgatctgttccgcgatctgccgaaagttcag
tacgatctgattgtcactaacccgccttatgtcgatgcggaggatatgtccgatctgccg
aacgaatatcgccacgaacctgagctggggctggcgtccggcactgacggcctcaaattg
acccgtcgtatcctgggaaatgcgccggattatctgtccgatgacggcgttctgatttgt
gaagtcggaaacagcatggtacatctgatggagcagtatccggatgtgccgttcacctgg
ctggagtttgacaacggcggcgatggcgtctttatgttgaccaaagcgcagttgctcgcg
gcccgtgaacatttcaatatttataaagattaa

DBGET integrated database retrieval system