KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2386Help
Entry
STM2386           CDS       T00065                                 

Gene name
yfcN
Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2496759..2497310
Genome map
AA seq 183 aa AA seqDB search
MKKKTSLSEEDQALFRQLMVGTRKIKQDTIVHRPLRKKITEVPTRRLIQEQADASHYFSD
EFQPLLNTEGPVKYVREDVSHFELKKMRRGDYSPELFLDLHGLTQLQAKQELGALIAACR
REHIFCACVMHGHGKHILKQQTPLWLAQHPHVMAFHQAPKEYGGDAALLVLIEVEEWQPP
ELP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaacatcgctcagcgaggaggaccaggcgctgttccgtcagctgatggtc
ggcacccgaaagattaaacaggatactatcgtccatcggccactgcgcaagaaaatcacg
gaagtccctacccgaaggttaattcaggaacaggcggacgccagccactatttttccgat
gagttccagccgctgctcaatacggaagggccggtaaagtatgtccgtgaagatgtcagc
catttcgagctaaaaaaaatgcgccgcggcgactattcgccggaactgtttctggattta
cacggcttaacgcagcttcaggccaagcaggaactgggggcgctgattgccgcctgccgt
cgggaacatattttttgcgcctgcgtcatgcatggacacggtaaacatattctgaaacag
caaacgccgttatggctggcgcagcatccgcatgtgatggcctttcatcaggcgccgaaa
gagtacggcggcgacgccgcgctgctggtgttgattgaagtggaagagtggcaaccgccc
gaattaccctga

DBGET integrated database retrieval system