KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2395Help
Entry
STM2395           CDS       T00065                                 

Gene name
pgtE
Definition
(RefSeq) hypothetical protein
  KO
K08477  outer membrane protease E [EC:3.4.21.-]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm01503  Cationic antimicrobial peptide (CAMP) resistance
stm02020  Two-component system
Module
stm_M00744  Cationic antimicrobial peptide (CAMP) resistance, protease PgtE
Brite
KEGG Orthology (KO) [BR:stm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    STM2395 (pgtE)
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    STM2395 (pgtE)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     STM2395 (pgtE)
Peptidases [BR:stm01002]
 Aspartic Peptidases
  Family A26: omptin family
   STM2395 (pgtE)
Antimicrobial resistance genes [BR:stm01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    STM2395 (pgtE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Omptin
Motif
Other DBs
NCBI-GeneID: 1253917
NCBI-ProteinID: NP_461336
UniProt: P06185
Position
complement(2506054..2506992)
Genome map
AA seq 312 aa AA seqDB search
MKKHAIAVMMIAVFSESVYAESALFIPDVSPDSVTTSLSVGVLNGKSRELVYDTDTGRKL
SQLDWKIKNVATLQGDLSWEPYSFMTLDARGWTSLASGSGHMVDHDWMSSEQPGWTDRSI
HPDTSVNYANEYDLNVKGWLLQGDNYKAGVTAGYQETRFSWTARGGSYIYDNGRYIGNFP
HGVRGIGYSQRFEMPYIGLAGDYRINDFECNVLFKYSDWVNAHDNDEHYMRKLTFREKTE
NSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIIDKTSGDTAYFGGDAAGIANN
NYTVTAGLQYRF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacatgctattgcagtaatgatgatcgccgtattttctgagtcggtttatgcg
gagtctgccttatttattccggacgtctctcctgatagcgtcacgacatccctttccgtg
ggtgtgttaaatggtaaatccagggagctggtttatgataccgacaccgggcggaagctg
agtcaactggattggaaaataaaaaatgtcgccacgttgcagggggatttatcatgggaa
ccctattcgttcatgacgctggacgcccgcggctggacgtctttggcgtcgggatcgggt
catatggttgaccatgactggatgagcagtgagcagccaggctggaccgatcgttcaatt
catccggacaccagcgtcaactatgctaatgaatacgatttgaacgtgaaaggttggtta
ttgcagggcgataactacaaggcgggcgtaacagcgggctatcaggaaacccgttttagc
tggacggcaagaggcgggtcttatatttatgataatggtcgatatattggtaattttcct
catggcgtgcgcggcataggttatagccagcgtttcgaaatgccctatatcgggctggcg
ggtgattatcgtattaatgactttgagtgtaatgtactgtttaaatacagcgactgggta
aatgcgcatgataatgacgaacactacatgcgcaaacttaccttccgtgaaaaaacggaa
aattcacgatattatggcgcttctattgacgccggatattatattaccagtaatgcaaaa
atctttgctgagtttgcttacagtaaatatgaagaaggtaagggcggtacgcaaatcata
gataaaaccagcggtgatacggcgtattttggtggcgatgccgcaggtatagctaataat
aactatacggttaccgcggggttgcagtatcgcttctag

DBGET integrated database retrieval system