KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2396Help
Entry
STM2396           CDS       T00065                                 

Gene name
pgtA
Definition
(RefSeq) transcriptional regulator
  KO
K08476  two-component system, NtrC family, phosphoglycerate transport system response regulator PgtA
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm02020  Two-component system
Module
stm_M00503  PgtB-PgtA (phosphoglycerate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:stm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    STM2396 (pgtA)
Two-component system [BR:stm02022]
 NtrC family
  PgtB-PgtA [MD:M00503]
   STM2396 (pgtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Sigma54_activ_2 Sigma54_activat HTH_8 HTH_17
Motif
Other DBs
NCBI-GeneID: 1253918
NCBI-ProteinID: NP_461337
UniProt: P06184
Position
complement(2507260..2508507)
Genome map
AA seq 415 aa AA seqDB search
MLNDECSILLIDDDVDVLDAYTQMLEQAGYRVRGFTHPFEAKEWVKADWEGIVLSDVCMP
GCSGIDLMTLFHQDDDQLPILLITGHGDVPMAVDAVKKGAWDFLQKPVDPGKLLILIEDA
LRQRRSVIARRQYCQQTLQVELIGRSEWMNQFRQRLQQLAETDIAVWFYGEHGTGRMTGA
RYLHQLGRNAKGPFVRYELTPENAGQLETFIDQAQGGTLVLSHPEYLTREQQHHLARLQS
LEHRPFRLVGVGSASLVEQAAANQIAAELYYCFAMTQIACQSLSQRPDDIEPLFRHYLRK
ACLRLNHPVPEIAGELLKGIMRRAWPSNVRELANAAELFAVGVLPLAETVNPQLLLQEPT
PLDRRVEEYERQIITEALNIHQGRINEVAEYLQIPRKKLYLRMKKYGLSKEHYKF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgatgaatgttctattttgctgattgatgatgacgttgatgtacttgacgcc
tatacccaaatgcttgagcaggcaggctaccgcgtgcgtggctttacccatcctttcgag
gccaaagagtgggtaaaagcggattgggaggggatcgttttgagcgatgtgtgtatgccg
gggtgttccggtatcgatctgatgacgctgtttcatcaggatgacgatcaactgccaatc
ttattgattaccggacatggcgatgtaccgatggcggttgatgcggtgaaaaagggcgcc
tgggattttctgcaaaaacccgtcgatccgggcaagctgttgatattaattgaagacgcg
ctacgccagcgccggtcggtcattgcacggcggcaatattgccagcagacgttacaggtt
gaactgattgggcgcagcgagtggatgaatcagtttcgacaacggttacaacaactggcg
gaaacggacattgccgtatggttttacggtgagcatggcactggacgtatgactggcgcc
cgttatctccatcaactggggcgtaacgcgaaagggccgtttgtacgctatgaacttacg
ccggagaatgccgggcagttggagacattcatcgaccaggcgcaaggaggcacgctggtg
ttgagtcatcccgaatatctgacacgcgaacagcagcaccatctggcgcgtttacaaagc
ctggagcatcggccttttcgtttggtgggcgttggcagcgcttcgctggtggagcaggcg
gcagctaaccagattgcagccgagctttactactgtttcgccatgacccaaatcgcctgc
cagtctctttctcagcgaccggatgatatcgagccgttatttcgccattatcttcgaaaa
gcctgcctgcgactcaatcatccagtgccggaaatagcgggggaattactgaaaggaata
atgcgacgcgcctggccaagcaatgtgcgcgaactggctaatgcggcagagctttttgct
gttggcgtgctgccgctggcggaaacggtcaacccgcagttgcttcttcaggagccgacc
ccgcttgaccggcgcgttgaagagtatgagcgacaaatcattaccgaagcattaaatatt
catcagggacgaattaatgaagtggcggagtacctgcaaattccccgtaaaaaactttat
ctgcgcatgaaaaaatatggtctaagtaaagagcattataaattctga

DBGET integrated database retrieval system