KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2401Help
Entry
STM2401           CDS       T00065                                 

Gene name
ddg
Definition
(RefSeq) lipid A biosynthesis palmitoleoyl acyltransferase
  KO
K12974  KDO2-lipid IV(A) palmitoleoyltransferase [EC:2.3.1.242]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
Enzymes [BR:stm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.242  Kdo2-lipid IVA palmitoleoyltransferase
     STM2401 (ddg)
Lipopolysaccharide biosynthesis proteins [BR:stm01005]
 Lipid A
  STM2401 (ddg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lip_A_acyltrans DUF374
Motif
Other DBs
NCBI-GeneID: 1253923
NCBI-ProteinID: NP_461342
UniProt: Q8ZNA3
Position
2514560..2515480
Genome map
AA seq 306 aa AA seqDB search
MFPQSKFSRAFLHPRYWLTWFGVGILWLLVQLPYPVLRFLGTRTGKLARPFLKRRESIAQ
KNIELCFPTLSREEREKLIAENFHSLGMALLETGMAWFWPDSRVRKWFDVDGLDNLTRAQ
AQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNPLMEWVQTRGRMRSNKAMIGRN
NLRGIVGALKKGEAVWFAPDQDYGPKGSSFAPFFAVENVATTNGTYVLSRLSGAAMLTVT
MVRKSDNSGYRLYITPEMEGYPADENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPLG
EASLYI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctcaaagcaaattttcacgcgcgtttttgcacccgcgctactggctgacgtgg
tttggcgttggcatcctctggttactggtgcagcttccctacccggttttgcgttttctg
ggcacccgcaccggtaaactggcgcgccccttcctgaagcgacgtgagtcaatcgcccag
aaaaatattgaactctgttttccgaccctctcccgggaagaaagggaaaaactgatcgcc
gagaatttccactctcttggcatggcgctgcttgaaacgggcatggcctggttctggcct
gatagccgggttcgcaaatggtttgatgtggacgggctggacaaccttacccgtgcgcag
gcgcaaaatcgcggcgtaatggtcgttggcgtgcattttatgtcgctggaattgggaggc
cgggtaatgggtctctgccagccgatgatggcgacctatcgtccgcataacaatccgctc
atggagtgggtgcagacgcgcggtcgtatgcgctcaaataaagcgatgatcggcagaaac
aatctgcgcggcattgtgggcgcgctaaaaaaaggggaagccgtttggtttgctcccgac
caggactacggccctaaaggcagctcctttgcgccatttttcgcggttgaaaacgtcgcc
accaccaacggcacctatgtactgtccaggctgtctggcgccgccatgttgaccgttaca
atggtaaggaaatccgataactcgggttatcgtctgtatattacccctgaaatggaaggt
tacccggcagatgaaaatcaagccgctgcctatatgaataaaattattgagaaagagatc
atgcgcgccccggagcaatatctctggatccatcgccgtttcaagactcgcccgttgggg
gaagcgtcactctacatctga

DBGET integrated database retrieval system