KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2414Help
Entry
STM2414           CDS       T00065                                 

Gene name
yfeD
Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2529716..2530108
Genome map
AA seq 130 aa AA seqDB search
MKRLRSKMTTEELAECLGVARQTVNRWIREQHWKTEKFPGVKGGRARLIHIDASVREFIL
NIPAFRKLPAFYQAEEAFAEYANAAHSHAYRQIIDAVENMSAQEQEKLALFLSREGIRGF
LTRLGINEAD
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattacgcagtaaaatgaccactgaagagctggctgaatgcctcggcgtggcc
agacaaaccgtcaatcgctggatcagagaacaacactggaaaaccgaaaaatttcccggc
gtcaaaggcggacgcgcaagactcatccatattgatgccagcgtgcgggagtttattctc
aatattccggcttttcgcaaactgcctgcgttttatcaggcggaagaggctttcgcagaa
tatgcgaacgcggcgcacagtcatgcttatcgacaaattattgatgccgttgaaaatatg
tctgctcaggaacaggaaaaactggcgctgtttttatcgcgggaaggtattcgcggattt
ctgacgcgtttaggtatcaatgaggcggactaa

DBGET integrated database retrieval system