KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2427Help
Entry
STM2427           CDS       T00065                                 

Gene name
lig
Definition
(RefSeq) DNA ligase (NAD(+)) LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm03030  DNA replication
stm03410  Base excision repair
stm03420  Nucleotide excision repair
stm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:stm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    STM2427 (lig)
   03410 Base excision repair
    STM2427 (lig)
   03420 Nucleotide excision repair
    STM2427 (lig)
   03430 Mismatch repair
    STM2427 (lig)
Enzymes [BR:stm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     STM2427 (lig)
DNA replication proteins [BR:stm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     STM2427 (lig)
DNA repair and recombination proteins [BR:stm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     STM2427 (lig)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     STM2427 (lig)
   MMR (mismatch exicision repair)
    DNA ligase
     STM2427 (lig)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      STM2427 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD PTCB-BRCT HHH Prok-E2_C Zn-ribbon_8
Motif
Other DBs
NCBI-GeneID: 1253949
NCBI-ProteinID: NP_461362
UniProt: Q8ZN89
Position
complement(2539000..2541015)
Genome map
AA seq 671 aa AA seqDB search
MEPIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELRELEAQRPDLITPDSPTQ
RVGAAPLTAFNQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKSTENVIWCCELKLDGLA
VSILYENGVLVSAATRGDGTTGEDITSNVRTIRAIPLKLHGDNIPARLEVRGEVFLPQAG
FEKINEDARRTGGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGILEGGELPDTHL
GRLLQFKAWGLPVSDRVTLCDSPQAVLDFYHNVEKDRPTLGFDIDGVVIKVNSLALQELL
GFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPVARLEPVQVAGVLVSNATLHN
ADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEETRPIVFPTHCPVCGSDVERVEG
EAVTRCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEREYVHTPADLFRLTAG
KLTGLDRMGPKSAQNVVNALEKSKTTTFARFLYALGIREVGEATAAGLAAYFGTLEALQA
ATIDELQKVPDVGIVVATHVFNFFAEESNRDVIGQLLAEGVHWPAPVVINVQEIDSPFAG
KTVVLTGSLSQMSRDDAKARLVALGAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGITVI
DEAEMIRLLGA
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaatcgaacaacaactgacagaactgcgaaccacgcttcgccatcatgaatat
ctgtatcatgtgatggatgcgccagagattcccgacgccgaatatgaccgcctgatgcgg
gaactgcgagagctggaggcgcaacgtccggaccttatcacgccggattcgcccacgcag
cgcgttggcgcggcgccgctgacggcattcaaccagattcgccatgaagtaccgatgctg
tcgctcgataacgtatttgatgaagaaagcttcctggcgtttaacaagcgagtgcaggat
cgtctaaaaagcacggaaaatgtcatctggtgctgcgagctaaagctggatggtctggcg
gtcagcattctgtatgaaaacggcgtgctggtgagcgctgcgacgcgtggcgacggcacc
accggtgaagatatcacttcaaacgtgcgcacgattcgcgccattccgttaaagctgcac
ggcgataacattccggcgcgtcttgaagttcgcggagaggtatttttaccgcaggccggg
tttgaaaagatcaatgaagacgcgcgccgcactggcggcaaagtgtttgctaacccgcgt
aacgcggcggcgggttcgctgcgtcagctcgatccgcgtattacggcgaagcgaccgcta
acatttttctgctacggcgtcggtattctggaaggcggcgagttgccggatacgcatctg
ggacgtttgctgcaatttaaagcgtgggggttaccggtcagcgatcgcgtgacgctgtgc
gattctccccaggcggtactggatttttatcacaacgtcgaaaaagatcgccctacgctc
ggttttgatatcgacggcgtggtgattaaggtcaactcgctggctttgcaggaactgctg
ggctttgtggcccgcgcgccgcgctgggcggtggcgtttaaatttcctgctcaggagcag
atgacttttgtgcgcgacgttgagtttcaggtcgggcgtaccggggcgattacgccggtg
gcgcgtctggaaccggttcaggtggctggtgtgctggtcagcaatgccacgttgcataat
gccgatgaaattgagcgacttggcttgcgcattggcgataaggtggttatccgtcgggca
ggcgatgtgatccctcaggtggtcaacgtggttctgtccgaacgccctgaagagacgcgt
ccgattgtgtttccaacgcactgtccggtgtgcggatcggacgtagagcgcgttgaaggc
gaagccgttacccgttgtaccggcgggctgatttgcggcgcgcagcgtaaagagtcgctg
aaacattttgtgtcgcgccgggcgatggatgtagacgggatgggcgataagatcatcgac
caactggtggaaagggagtatgtccatacgccagcggatctgttccgtctgacggcgggt
aaactgaccggcctggaccgaatggggccaaagtccgcgcaaaatgttgttaacgcgctg
gaaaaatccaaaacgacgacctttgcgcgttttctctatgcgctgggcatccgtgaagtg
ggtgaagcgacggcggcggggctggcggcttatttcggtacgctggaggcgctgcaggcc
gccaccattgacgagttgcagaaagtacctgacgtggggattgtggtcgctacgcacgtc
tttaacttttttgccgaagagagtaatcgtgacgtgattgggcagctactggcggaaggg
gttcactggcccgcgccggtagtcattaatgtgcaagagatcgatagcccgtttgccggt
aaaaccgtggtactaaccggtagcctgagccagatgtctcgcgatgacgctaaagcgcgt
ttagtggcgctgggcgcgaaagtggcaggcagcgtatcgaagaaaaccgatctggtgatt
gccggtgaagcggcgggctccaaactggccaaagcgcaggaactgggtattaccgtgatt
gatgaagcggaaatgatccgcttactgggtgcctga

DBGET integrated database retrieval system