KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2434Help
Entry
STM2434           CDS       T00065                                 

Definition
(RefSeq) hypothetical protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 1253956
NCBI-ProteinID: NP_461369
UniProt: Q8ZN88
Position
complement(2547317..2547556)
Genome map
AA seq 79 aa AA seqDB search
MKSYRLVVRQQGRIVGHFETSGLDALEDICVARAMFGITGGYQCELQVSDSERRMLESGP
DGMKILMREKCFRPVTSQL
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttatcggctggtggttcgccagcagggacgtatcgtggggcattttgaaacg
agcgggctggacgcgctggaagatatctgcgtggcgcgagcgatgtttggcatcactggc
ggctatcagtgcgagctgcaagtgtccgattccgaacgcaggatgctggagagtggcccg
gatgggatgaagatcctgatgcgcgagaagtgctttcgcccggtgacctcgcagttgtaa

DBGET integrated database retrieval system