KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2436Help
Entry
STM2436           CDS       T00065                                 

Gene name
ptsJ
Definition
(RefSeq) transcriptional regulator PtsJ
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2548502..2549794
Genome map
AA seq 430 aa AA seqDB search
MIDGKTANEIFDSIRQHIIAGTLRAEDSLPPVRELASELKVNRNTVAAAYKRLITAGLAQ
SLGRNGTVIKGSPSPVALEGGDPHTPLHDLSGGNPDPQRLPDLSRYFARLSRTPHLYGDA
PVSPELHAWAARWLRDATPVAGEIDITSGAIDAIERLLCAHLLPGDSVAVEDPCFLSSIN
MLRYAGFSASPVSVDSEGMQPEKLERALNQGARAVILTPRAHNPTGCSLSARRAAALQNM
LARYPQVVVIIDDHFALLSSSPWQPVIAQTTQHWAVIRSVSKTLGPDLRLAIVASDSATS
AKLRLRLNAGSQWVSHLLQDLVYACLTDPEYQHRLTQTRLFYAARQQKLARALQQYGIAI
SPGDGVNAWLPLDTHSQATAFTLAKSGWLVREGEAFGVSAPSHGLRITLSTLNDSEINTL
AADIHQALNR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacggaaaaaccgctaacgaaatttttgacagtatccgtcaacacattatcgcc
ggcacgttacgggcggaggattcgctcccgccggtacgggagctggcaagcgaattaaag
gtgaaccgcaataccgtcgcagcggcgtataaacggctgataacggcgggactggcgcaa
agtttaggccgcaatgggacggtgattaaaggcagtccgtctcccgtagcgctggaaggc
ggcgatccacatacgcctctgcacgacctttccggcggcaatcccgatccgcagcgtctg
cctgaccttagccgttattttgcccgtctcagccgcacgccgcatctctacggcgatgcg
cccgtttcccctgaactacacgcctgggcggcgcgctggctacgggatgccacccccgtc
gcaggcgaaattgatatcaccagcggagctatcgacgccattgaaagactgctttgcgcg
catctgctgccgggcgacagcgtcgcggtggaagatccctgttttttaagcagtatcaat
atgctgcgctatgccggttttagcgccagcccggtcagtgtggatagcgaaggaatgcag
cctgaaaagctggaacgggcgctaaatcagggcgcgcgggcagtgatcttaacgccgcgc
gcgcacaaccctaccggctgtagcctgagcgctcgccgtgccgctgcgctgcaaaatatg
ctggcgcgttaccctcaggtagtggtcattatcgacgatcacttcgccctgctttcttcg
tcgccctggcagccggttattgcgcagacaacgcaacactgggcggtgatacgctccgtt
tccaaaaccctcggccccgatttacgtcttgctattgtcgccagcgacagcgcgacctcg
gcaaaacttcggctgcggctaaatgccggtagtcagtgggtcagccatctgttacaggat
ctggtctacgcctgcctgaccgaccctgagtatcagcacaggctgacgcaaacgcggctg
ttttacgccgcccggcaacaaaaactggcccgcgccctacagcaatatggcatcgccatt
tctcccggcgacggcgtgaatgcctggctcccactggacacccatagccaggctaccgcg
tttacgttggcaaaatccggctggctggtacgtgagggagaagcctttggcgtaagcgcg
ccgtctcacggtctacgtatcacgctgtcgacattaaatgacagcgagatcaacacgctg
gcggctgatatccatcaggcgctaaatcgctaa

DBGET integrated database retrieval system