KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2437Help
Entry
STM2437           CDS       T00065                                 

Gene name
yfeJ
Definition
(RefSeq) putative GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00230  Purine metabolism
stm01100  Metabolic pathways
Module
stm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STM2437 (yfeJ)
Enzymes [BR:stm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     STM2437 (yfeJ)
Peptidases [BR:stm01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   STM2437 (yfeJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 DJ-1_PfpI GATase_3
Motif
Other DBs
NCBI-GeneID: 1253959
NCBI-ProteinID: NP_461372
UniProt: P40194
Position
2549809..2550528
Genome map
AA seq 239 aa AA seqDB search
MRVHFVVHESFESAGAYLKWAEDRGYTISWSRVYAGEALPPNADEFDMLVVFGGPQSPRT
TREECPYFDSRAEQHLINQAVTARRMVIGICLGSQLIGEALGAAVCQSPEKEIGHYPITL
TEAGLRHPLIAHFGSPLTVGHWHNDMPGLTDQATVLAESEGCPRQIVQYGNFVYGFQCHM
EFTVEAVEGLIQHSQQELADAQGKRFIRSVAEMRAWNYQQMNEKLWRFLDELTLAHSQK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagttcattttgttgtccatgagtcgtttgaatccgctggcgcttatctgaaatgg
gctgaagatcgcggttataccatttcatggtcgcgcgtctatgccggagaagcgctaccg
cccaatgccgatgagttcgatatgctcgtggtatttggcggtccgcagtcgccgcgcacc
acccgcgaagagtgcccgtactttgactctcgcgccgaacagcacttaattaatcaggca
gttacggcccggcgaatggttatcggcatttgtcttggttcgcagctcattggcgaggcg
ctgggcgccgctgtgtgccaaagtccggaaaaagagattggtcactaccctattacgctc
actgaagccggtctgcggcatccgcttatcgcccactttggctccccgttaaccgtcggc
cactggcacaacgatatgccaggactcaccgatcaggcgaccgtgctggccgaaagcgaa
ggctgtccacgtcagatagtgcagtacggtaattttgtctacggcttccagtgtcatatg
gaatttaccgtcgaggcggttgaaggattaatccaacattcgcagcaggagctggccgac
gcgcaagggaagcgttttatccgctcggtcgccgagatgcgcgcatggaattaccagcaa
atgaatgaaaagctgtggcgttttctggatgaactcacgctggcgcactcacagaaataa

DBGET integrated database retrieval system