KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2444Help
Entry
STM2444           CDS       T00065                                 

Gene name
cysP
Definition
(RefSeq) thiosulfate transporter subunit
  KO
K02048  sulfate transport system substrate-binding protein
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00920  Sulfur metabolism
stm02010  ABC transporters
Module
stm_M00185  Sulfate transport system
stm_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    STM2444 (cysP)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    STM2444 (cysP)
Transporters [BR:stm02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    STM2444 (cysP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1 SBP_bac_8 SBP_bac_6 PBP_like PBP_like_2
Motif
Other DBs
NCBI-GeneID: 1253966
NCBI-ProteinID: NP_461379
UniProt: P41031
Position
complement(2555424..2556440)
Genome map
AA seq 338 aa AA seqDB search
MAVNLLKKRPLTLAAMLLLAGQAQATELLNSSYDVSRELFAALNPPFEQQWAKDNGGDKL
TIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLIPADWQSRLPNNSSPFYS
TMGFLVRKGNPKNIHDWSDLVRSDVKLIFPNPKTSGNARYTYLAAWGAADNADGGDKAKT
EQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKT
NILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIITHYYYRVNNPEIMGKQADKF
PQTELFRVEEKFGSWPEVMKTHFASGGELDKLLAAGRK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggccgttaacttactgaaaaagagacccctgacgctggcagcaatgctgttactggca
gggcaggcgcaggcaacggagctgctgaacagctcatacgatgtctcccgcgagctgttt
gccgcccttaacccgccgtttgagcaacaatgggcgaaggataacggcggcgataagctg
acgattaagcagtctcatgccgggtcatcaaaacaggcgctggcgattttgcagggactg
aaggcagacgtcgtcacctacaatcaggtgaccgacgtacagattcttcatgataaaggc
aaactgatccctgccgactggcaaagccgtctgccgaacaacagttcgccattctattcc
acgatgggtttcctggtgcgcaagggaaacccgaaaaatattcacgactggagcgatctt
gtacgttccgacgtgaagctgattttccctaacccgaaaacctccggcaacgcccgttac
acgtatctggcggcatggggcgcggcggataacgcggacggcggcgataaagccaaaacc
gaacagtttatgacccagttcctgaaaaacgtcgaagtgtttgataccggcggtcgcggc
gctacgactacctttgccgagcgtggtctgggcgatgtgctgattagttttgagtcggaa
gtgaacaatatccgcaaacaatatgaagcccagggatttgaagtggtgatcccgaaaacg
aacattcttgctgaattcccggttgcctgggtggataaaaacgtgcaggccaacggcaca
gaaaaagccgccaaagcttacctgaactggctgtatagcccgcaggcgcagaccatcatc
acccattactactaccgcgtgaataacccggaaatcatgggcaagcaagcagataaattc
ccgcagaccgaactgttccgcgtggaagaaaagtttggttcctggccggaagtgatgaaa
acgcactttgccagcggcggcgagctggacaaactgttggcggcggggcgtaagtaa

DBGET integrated database retrieval system