KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2458Help
Entry
STM2458           CDS       T00065                                 

Gene name
eutB
Definition
(RefSeq) ethanolamine ammonia-lyase large subunit
  KO
K03735  ethanolamine ammonia-lyase large subunit [EC:4.3.1.7]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00564  Glycerophospholipid metabolism
stm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    STM2458 (eutB)
Enzymes [BR:stm01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.7  ethanolamine ammonia-lyase
     STM2458 (eutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EutB
Motif
Other DBs
NCBI-GeneID: 1253980
NCBI-ProteinID: NP_461393
UniProt: P19264
Position
complement(2567250..2568611)
Genome map
AA seq 453 aa AA seqDB search
MKLKTTLFGNVYQFKDVKEVLAKANELRSGDVLAGVAAASSQERVAAKQVLSEMTVADIR
NNPVIAYEEDCVTRLIQDDVNETAYNRIKNWSISELREYVLSDETSVDDIAFTRKGLTSE
VVAAVAKICSNADLIYGGKKMPVIKKANTTIGIPGTFSCRLQPNDTRDDVQSIAAQIYEG
LSFGAGDAVIGVNPVTDDVENLTRVLDTVYGVIDKFNIPTQGCVLAHVTTQIEAIRRGAP
GGLIFQSICGSEKGLKEFGVELAMLDEARAVGAEFNRIAGENCLYFETGQGSALSAGANF
GADQVTMEARNYGLARHYDPFLVNTVVGFIGPEYLYNDRQIIRAGLEDHFMGKLSGISMG
CDCCYTNHADADQNLNENLMILLATAGCNYIMGMPLGDDIMLNYQTTAFHDTATVRQLLN
LRPSPEFERWLETMGIMANGRLTKRAGDPSLFF
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaagaccacattgttcggcaatgtttatcagtttaaggatgtaaaagaggta
ctggctaaagccaacgaactgcgttcgggggatgtgctggccggggttgccgcggcaagt
tcgcaggagcgcgtagcggcaaaacaggtactgtcggaaatgacggtggcggatatccgc
aacaatccggtgattgcctatgaagaggactgcgtgacgcgcctgattcaggacgacgtc
aacgaaacggcctataaccggattaaaaactggagcatcagcgaactgcgtgaatacgtg
ctgagcgatgaaacctccgtggacgacatcgcgtttacccgcaaaggcctgacctccgaa
gtggtggcggcagtagcgaaaatctgctccaacgctgacctgatctacggcggcaagaaa
atgccggtgatcaaaaaagccaataccaccatcggtattccgggcacctttagctgccgt
ttgcagccgaacgatacccgtgacgatgtacagagtatcgccgcgcaaatctacgaaggg
ctttctttcggcgcaggcgatgcggtgatcggcgttaacccggtgaccgatgacgtggag
aacctgacccgcgtgctcgacaccgtttacggcgttatcgataaattcaatattccgacc
cagggctgcgtgctggcgcacgtcaccacccagatcgaagcgattcgtcgcggcgcgccg
ggcggactgattttccagagcatttgcggcagcgagaagggcttaaaagagttcggcgtc
gagctggccatgctcgacgaagcgcgggctgtgggggcggagttcaaccgcatcgccggg
gaaaactgcctgtactttgaaaccgggcaagggtctgcgctctccgcaggcgcgaacttt
ggtgccgaccaggtgacgatggaagcgcgtaactacgggctggcgcgccactacgatccg
ttcctggtgaacaccgtggtgggctttatcgggccggagtatctctacaacgacaggcag
attatccgcgccggtctcgaagatcactttatgggcaagctgagcggcatctcgatgggc
tgcgactgctgctataccaaccatgccgacgccgaccagaaccttaacgaaaacctgatg
attctgctcgccactgccggctgtaactacatcatggggatgccgctcggcgacgacatc
atgctcaactaccagaccaccgctttccacgataccgccaccgtccgtcagttgctgaat
ttacggccgtcgccggagtttgaacgctggctggaaacgatgggcattatggcaaacggt
cgtctgaccaaacgggcgggcgatccgtcactgttcttctga

DBGET integrated database retrieval system