KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM2549Help
Entry
STM2549           CDS       T00065                                 

Gene name
asrB
Definition
(RefSeq) anaerobic sulfite reductase subunit B
  KO
K16951  anaerobic sulfite reductase subunit B
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00920  Sulfur metabolism
stm01100  Metabolic pathways
stm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    STM2549 (asrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 DHODB_Fe-S_bind FAD_binding_6
Motif
Other DBs
NCBI-GeneID: 1254071
NCBI-ProteinID: NP_461484
UniProt: P26475
Position
2687491..2688309
Genome map
AA seq 272 aa AA seqDB search
MSHCSCHDKPQHSLLPAAYRILSITRHTPLEWNFRVAVDFPAHWGQFVEVSLPRVGEAPI
SVSDYGDGWIDLLIRNVGKVTSALFTLKEGDNVWLRGCYGNGYPVDTLRHKPLLVVAGGT
GVAPVKGLMRYFVENPQEIGQLDMILGYKNRDCVLYKEEMATWRGKHNLVLTLDEGEADD
RYQIGRVTDRLADMTLSDIDTMQAIVVGPPIMITFTVKMLLQKGLKPEQIWVDYERRMAC
SVGKCGHCRMGEVYVCTDGPIFNYAVAQRFAD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcacattgttcctgtcatgataaaccgcagcacagtttgctgcctgcggcgtaccgc
atcctcagtattactcgccacacgccgctggagtggaatttccgcgtggccgtcgatttt
cccgcgcactgggggcaatttgttgaggtgtcgctgccgcgcgtcggcgaagcgcccatc
tccgtttccgactacggcgacggctggatagatctgctgattcgtaatgtcggaaaagtg
accagcgccctctttacgctgaaagaaggcgacaacgtgtggctacgcggctgctatggc
aatggctatccggtcgatacgctgcgccataagcccttactggttgtcgcaggcggtacg
ggcgtcgcgccggtgaaaggcttaatgcgctatttcgttgagaatccccaggaaattggt
caactggatatgattctcggctataaaaatcgcgattgcgtgctgtacaaagaagaaatg
gcgacgtggcgcggcaaacataatctggtactcacgctggatgaaggcgaggctgatgac
cgttaccagattggccgggtgaccgatcggcttgccgacatgacgcttagcgatatcgac
actatgcaggccatcgtcgttgggccgccaataatgattacctttaccgtaaaaatgctg
ctgcaaaaagggctcaagccggagcaaatctgggtggactacgaacgccggatggcctgc
tccgtcgggaagtgcggccactgccgtatgggcgaagtgtatgtctgcaccgacggtccg
atatttaactacgccgtcgcgcaacgttttgccgattaa

DBGET integrated database retrieval system