KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3068Help
Entry
STM3068           CDS       T00065                                 

Gene name
fba
Definition
(RefSeq) fructose-bisphosphate aldolase (EC:4.1.2.13)
  KO
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STM3068 (fba)
   01230 Biosynthesis of amino acids
    STM3068 (fba)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STM3068 (fba)
   00030 Pentose phosphate pathway
    STM3068 (fba)
   00051 Fructose and mannose metabolism
    STM3068 (fba)
  Energy metabolism
   00680 Methane metabolism
    STM3068 (fba)
Enzymes [BR:stm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     STM3068 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3229511..3230590)
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQ
FSNGGASFIAGKGVKTDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLHENIEICSKYLARMSKIGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQDYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGV
LNYYKENEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFKELNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatttttgatttcgtaaaaccaggcgtgatcactggtgatgacgtacagaaa
gtgttccaggtagcaaaagaaaacaattttgctctgccggcagttaactgcgtgggcact
gattccatcaacgctgttctggaaaccgctgcaaaagttaaagcaccggtcatcgttcag
ttctccaacggcggcgcttccttcatcgcgggtaaaggcgtgaaaactgacgtacctcag
ggcgcggcaatcctgggcgctatctctggcgcgcatcacgttcaccagatggctgaacac
tacggcgttccggttatcctgcacactgaccactgcgcgaagaaactgctgccgtggatc
gatggcctgctggacgcgggtgaaaaacactttgcggctaccggtaaaccgctgttctct
tctcacatgattgacctgtctgaagagtctctgcacgaaaacatcgaaatctgctccaaa
tacctggcgcgcatgtccaaaattggcatgactctggaaatcgaactgggttgcaccggt
ggtgaagaagacggcgtggacaacagccacatggacgcttctgctctgtacacccagccg
gaagacgttgattacgcgtacactgaactgagcaaaatcagcccgcgtttcaccattgcc
gcttccttcggtaacgtacacggcgtttacaagccgggtaacgtggttctgaccccgacc
attctgcgtgattctcaggactatgtttctaagaaacacaacctgccgcacaacagcctg
aacttcgttttccacggcggttccggttctactgctcaggaaatcaaagactccgtaagc
tacggcgtagtgaaaatgaacatcgataccgatacccaatgggcaacctgggaaggtgtt
ctgaactactacaaagaaaacgaagcgtatctgcaaggtcagctgggcaacccgaaaggc
gaagatcagccgaacaagaaatactatgacccgcgcgtatggctgcgtgctggccagact
tcgatgatcgctcgtctggaaaaagcatttaaagaactgaacgcgattgacgttctgtaa

DBGET integrated database retrieval system