KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3068Help
Entry
STM3068           CDS       T00065                                 

Gene name
fba
Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Gluconeogenesis, oxaloacetate => fructose-6P
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:stm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:stm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:stm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:stm00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:stm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3229511..3230590)
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQ
FSNGGASFIAGKGVKTDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLHENIEICSKYLARMSKIGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQDYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGV
LNYYKENEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFKELNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatttttgatttcgtaaaaccaggcgtgatcactggtgatgacgtacagaaa
gtgttccaggtagcaaaagaaaacaattttgctctgccggcagttaactgcgtgggcact
gattccatcaacgctgttctggaaaccgctgcaaaagttaaagcaccggtcatcgttcag
ttctccaacggcggcgcttccttcatcgcgggtaaaggcgtgaaaactgacgtacctcag
ggcgcggcaatcctgggcgctatctctggcgcgcatcacgttcaccagatggctgaacac
tacggcgttccggttatcctgcacactgaccactgcgcgaagaaactgctgccgtggatc
gatggcctgctggacgcgggtgaaaaacactttgcggctaccggtaaaccgctgttctct
tctcacatgattgacctgtctgaagagtctctgcacgaaaacatcgaaatctgctccaaa
tacctggcgcgcatgtccaaaattggcatgactctggaaatcgaactgggttgcaccggt
ggtgaagaagacggcgtggacaacagccacatggacgcttctgctctgtacacccagccg
gaagacgttgattacgcgtacactgaactgagcaaaatcagcccgcgtttcaccattgcc
gcttccttcggtaacgtacacggcgtttacaagccgggtaacgtggttctgaccccgacc
attctgcgtgattctcaggactatgtttctaagaaacacaacctgccgcacaacagcctg
aacttcgttttccacggcggttccggttctactgctcaggaaatcaaagactccgtaagc
tacggcgtagtgaaaatgaacatcgataccgatacccaatgggcaacctgggaaggtgtt
ctgaactactacaaagaaaacgaagcgtatctgcaaggtcagctgggcaacccgaaaggc
gaagatcagccgaacaagaaatactatgacccgcgcgtatggctgcgtgctggccagact
tcgatgatcgctcgtctggaaaaagcatttaaagaactgaacgcgattgacgttctgtaa

DBGET integrated database retrieval system