KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3068Help
Entry
STM3068           CDS       T00065                                 

Gene name
fba
Definition
(RefSeq) class II fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00010  Glycolysis / Gluconeogenesis
stm00030  Pentose phosphate pathway
stm00051  Fructose and mannose metabolism
stm00680  Methane metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
stm01130  Biosynthesis of antibiotics
stm01200  Carbon metabolism
stm01230  Biosynthesis of amino acids
Module
stm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
stm_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STM3068 (fba)
   00030 Pentose phosphate pathway
    STM3068 (fba)
   00051 Fructose and mannose metabolism
    STM3068 (fba)
  Energy metabolism
   00680 Methane metabolism
    STM3068 (fba)
Enzymes [BR:stm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     STM3068 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase S-methyl_trans
Motif
Other DBs
NCBI-GeneID: 1254591
NCBI-ProteinID: NP_461984
UniProt: Q7CPU6
Position
complement(3229517..3230596)
Genome map
AA seq 359 aa AA seqDB search
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQ
FSNGGASFIAGKGVKTDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLHENIEICSKYLARMSKIGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQDYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGV
LNYYKENEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFKELNAIDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatttttgatttcgtaaaaccaggcgtgatcactggtgatgacgtacagaaa
gtgttccaggtagcaaaagaaaacaattttgctctgccggcagttaactgcgtgggcact
gattccatcaacgctgttctggaaaccgctgcaaaagttaaagcaccggtcatcgttcag
ttctccaacggcggcgcttccttcatcgcgggtaaaggcgtgaaaactgacgtacctcag
ggcgcggcaatcctgggcgctatctctggcgcgcatcacgttcaccagatggctgaacac
tacggcgttccggttatcctgcacactgaccactgcgcgaagaaactgctgccgtggatc
gatggcctgctggacgcgggtgaaaaacactttgcggctaccggtaaaccgctgttctct
tctcacatgattgacctgtctgaagagtctctgcacgaaaacatcgaaatctgctccaaa
tacctggcgcgcatgtccaaaattggcatgactctggaaatcgaactgggttgcaccggt
ggtgaagaagacggcgtggacaacagccacatggacgcttctgctctgtacacccagccg
gaagacgttgattacgcgtacactgaactgagcaaaatcagcccgcgtttcaccattgcc
gcttccttcggtaacgtacacggcgtttacaagccgggtaacgtggttctgaccccgacc
attctgcgtgattctcaggactatgtttctaagaaacacaacctgccgcacaacagcctg
aacttcgttttccacggcggttccggttctactgctcaggaaatcaaagactccgtaagc
tacggcgtagtgaaaatgaacatcgataccgatacccaatgggcaacctgggaaggtgtt
ctgaactactacaaagaaaacgaagcgtatctgcaaggtcagctgggcaacccgaaaggc
gaagatcagccgaacaagaaatactatgacccgcgcgtatggctgcgtgctggccagact
tcgatgatcgctcgtctggaaaaagcatttaaagaactgaacgcgattgacgttctgtaa

DBGET integrated database retrieval system