KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3315Help
Entry
STM3315           CDS       T00065                                 

Gene name
yrbH
Definition
(RefSeq) D-arabinose 5-phosphate isomerase
  KO
K06041  
arabinose-5-phosphate isomerase [EC:5.3.1.13]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    STM3315 (yrbH)
Enzymes [BR:stm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.13  arabinose-5-phosphate isomerase
     STM3315 (yrbH)
Lipopolysaccharide biosynthesis proteins [BR:stm01005]
 Unusual sugar
  STM3315 (yrbH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
3480969..3481955
Genome map
AA seq 328 aa AA seqDB search
MSHLALQPGFDFQQAGKEVLEIEREGLAELDQYINQHFTLACEKMFNCTGKVVVMGMGKS
GHIGRKMAATFASTGTSSFFVHPGEAAHGDLGMVTPQDVVIAISNSGESSEIAALIPVLK
RLHVPLICITGRPESSMARAADVHLCVKVPKEACPLGLAPTSSTTATLVMGDALAVALLK
ARGFTAEDFALSHPGGALGRKLLLRVSDIMHTGDEIPHVNKHATLRDALLEITRKNLGMT
VICDESMKIDGIFTDGDLRRVFDMGGDMRQLGIAEVMTPGGIRVRPGILAVDALNLMQSR
HITSVLVADGDQLLGVLHMHDLLRAGVV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatttagcgttgcaaccggggtttgactttcagcaggcaggcaaagaggtcctg
gaaattgaacgtgaaggcctggcggagcttgatcaatatatcaaccagcatttcacgctg
gcctgtgaaaaaatgttcaactgcaccggaaaagtggtggtcatggggatggggaaatcc
ggccatatcggacggaaaatggccgccacgttcgccagtaccggcacctcttcctttttt
gtacatccgggcgaagccgcgcacggcgatttggggatggttacgccgcaggatgtggtt
atcgctatctccaactccggcgaatccagcgagatcgcggcgctaataccggtacttaaa
cgtctgcacgtgccgttaatttgcattaccgggcgaccggaaagcagcatggcgcgtgcg
gcagatgtgcatctgtgtgttaaagtgcccaaagaagcgtgtccgttaggactggcgcct
accagtagtaccaccgcaacgctggtgatgggcgacgcgctcgctgtggcgttgttaaaa
gcgcgcggctttaccgccgaggatttcgctctgtcgcatcctggcggcgcgctgggacgt
aagctactgctgcgcgtaagcgatattatgcatactggcgatgagatcccgcatgttaat
aaacatgccaccctgcgtgatgcgctattagaaattacgcgtaaaaatctcggtatgacc
gtcatttgcgatgaatccatgaagatcgacggtatcttcaccgacggcgatttacgtcgc
gtattcgatatgggcggcgatatgcgccagttggggatcgccgaggtgatgacgccaggg
ggcattcgcgtgcgtcccggtattctcgctgtcgatgcgctgaatttaatgcagtcccgc
catatcacctccgtactggttgctgatggcgaccagttactcggtgtgttacatatgcat
gatctcctgcgtgcaggcgtcgtgtag

DBGET integrated database retrieval system