KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3726Help
Entry
STM3726           CDS       T00065                                 

Gene name
mutM
Definition
(RefSeq) DNA-formamidopyrimidine glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:stm00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    STM3726 (mutM)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     STM3726 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     STM3726 (mutM)
DNA repair and recombination proteins [BR:stm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     STM3726 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS Auto_anti-p27 zf-dskA_traR
Motif
Other DBs
NCBI-GeneID: 1255250
NCBI-ProteinID: NP_462626
UniProt: O54326
Position
complement(3921143..3921952)
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWPVSDEIYRLSDTPVLSVQRRAKYLL
LELPDGWIIIHLGMSGSLRILPEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKEL
EGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVATKHAQRATFYCRHCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagccgccggggtattgaaccccatttagttggc
gctactatcctgcacgcccatatccgtaacggccgtctgcgctggccggtttcagatgaa
atttatcgtctgagcgatacacccgtccttagcgttcagcgtcgtgctaaatatctactg
ctggagctgcctgacggctggataattattcacctggggatgtcgggaagcttgcggata
ctgccggaagcgctgccggcggaaaagcacgaccatgtcgatttggtgatgagcaacggc
aaaattctacgttataccgatcctcgccgctttggcgcctggttatggaccaaagagctg
gaagggcataacgtactggcgcatctgggaccggagccgctaagcgatgagtttaatggc
gaatatttgcagcagaaatgcgcgaagaagaagacggcgattaaaccctggctgatggat
aacaagctggtggtcggcgtggggaatatctacgccagcgagtcgctgtttgccgctggt
attcaccctgaccgcctggcgtcgtcactctcgacagaggagtgcgacctgctggcgcgg
gtgattaaagccgttttgctgcgctctattgaacaaggcgggacaacgctgaaggatttt
ctgcaaagcgatgggaagccgggctattttgcccaggagttgcaggtgtacgggcgcaaa
ggcgagccgtgtcgggtatgcggtacgccgatagtcgcaacgaaacacgcacagcgcgcg
acgttctattgccgtcactgtcagaagtaa

DBGET integrated database retrieval system