KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3820Help
Entry
STM3820           CDS       T00065                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     STM3820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4018596..4019996)
Genome map
AA seq 466 aa AA seqDB search
MKKITLYATTVITVGLLCYLGLSGYVWYYDKQRSKKSDVQASVVGENNKILGYFREKGCD
YCHTPSAELPFYSSFPVAKQLMDYDIQLGYKSFNLEAVRAALIADTPVPQSELNKIEWVM
QHQTMPPTRYVALHWAGGVSDKERTDILNWIADQRERNYASADTDPAHRNEPVQPIPRNI
PVDAKKVDLGFRLYHDERLSGDSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNIEQFWDGRAATLQEQAGGPPLNPIEMASKSWDEIISKLDKDPVLKKDFQAVYPQG
FTGENITDAIAEFEKTLITPDSAFDKWLRGDENALTAQQKHGYQLFKENKCATCHGGIIL
GGRSFEPLGLKRDFNFGEITAADIGRMNVTKEVRDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGTDLPQNDIDDIVAFLESLTGVYTPYQPEYAQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaccctctatgcgacaacagttatcaccgttgggctgttatgttattta
ggtttgtccgggtatgtatggtattacgacaaacagcgcagtaaaaaaagcgatgtgcag
gcctcggttgtgggtgaaaataataaaatactgggttatttcagggagaaaggatgtgat
tattgtcatacgccttccgctgaattgcctttttattcctcttttccggtggcaaagcag
ctaatggattacgatatccagctcggctacaagtcgtttaacctggaggcggtacgggcc
gccctgattgcggatacgccggtgccgcaaagcgaactgaataaaattgaatgggttatg
caacatcagactatgccgccaacccgctatgtcgcgctgcactgggcggggggcgtcagc
gataaagagcgtactgacatcctgaactggatagccgatcagcgtgagcgcaactatgcc
agcgccgataccgacccggcgcaccggaatgaacccgttcagcctattccgcgcaatatt
cccgtcgatgcgaaaaaagtcgacttaggtttccggctttatcatgatgaacgtttatcc
ggcgacagcacaatatcctgtgcgcattgtcacgcgttaaatgcgggcggtgtcgatggc
agaaaaacctcaattggcgttggcggtgcggtaggaccaataaatgcgccgacggtattc
aactccgtatttaatatcgaacaattttgggatggtcgtgctgcaaccctgcaggagcaa
gcaggaggaccaccgttaaatcctattgaaatggcctctaaatcctgggatgaaattatt
agcaagcttgataaagatcctgtcctgaaaaaagatttccaggcggtttatccgcaagga
tttaccggggaaaatattactgatgcgatcgccgaattcgaaaaaacgttgataacgccg
gattccgcctttgataaatggctacgtggagatgaaaatgcgctgaccgcgcaacagaaa
cacggttatcaattatttaaagagaataaatgtgcaacctgtcacggcggtatcatttta
ggcgggcgctcttttgaaccattgggattaaagcgagactttaattttggcgaaattacc
gcagcggatattggtcgtatgaacgtcaccaaagaggttcgcgataaattacggcaaaaa
gtcccgggcttacgcaacgtcgcgttaacagcgccttatttccatcggggcgacgtaccg
acgctggatggagcggtaaaactgatgctgcgttatcaggttggcaccgatctgccgcaa
aacgatattgacgatatcgtcgccttcctggaaagcctgaccggtgtttatacgccatat
caacctgaatatgcgcaatga

DBGET integrated database retrieval system