KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3936Help
Entry
STM3936           CDS       T00065                                 

Gene name
hemX
Definition
uroporphyrinogen III C-methyltransferase (EC:2.1.1.107)
Orthology
K02496  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:stm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4143121..4144290)
Genome map
AA seq 389 aa AA seqDB search
MTEQEKSSAVVDETRESVETTPQPVNTEKKSKNGAALVLSAVAIAIALAAGIGLYGWGKQ
QATAQTETSDALATQLTALQKAQESQKAELEGIIKKQAAQLDDANRQQAALAKQLDEVQQ
KVATISGSDAKTWLLAQADFLVKLAGRKLWSDQDVTTAAALLKSADASLADMNDPSLITA
RRAITDDIASLSSVAQIDYDGIILKLNQLSNQIDNLRLADNDTDGSPMDSDSSELSSSLS
EWRVNLQKSWQNFMDSFITIRRRDDTAVPLLAPNQDVYLRENIRSRLLVAAQAVPRHQEE
TYRQALDNVSTWVRAYYDTDDAATKAFLEEVDKLSQQNITMDLPETLGSQAILEKLMQTR
VRNLLAQPTVSTAAPATQTDAPAAAPQGE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaagaaaaatcctccgccgtggttgatgagaccagggagagcgtggaaacc
acgccacagccagttaataccgagaaaaaaagtaagaacggcgccgcgctggtattaagc
gcggtggcgattgcgattgccctggcggcaggtattgggctttatggctgggggaaacag
caagcaaccgcgcaaacggaaaccagcgatgcgctggcgacgcaactgaccgccttgcaa
aaggcgcaggagagccaaaaagcggagctggaagggattatcaaaaaacaagcggcgcag
ttagatgacgcgaatcgccaacaggcggcgctggcgaaacagcttgatgaagtacaacaa
aaagtcgccactatttccggcagcgatgctaaaacctggctgctggcgcaggctgatttc
ctggtgaaactcgccggacgcaagctgtggagcgatcaggacgtcactaccgccgctgcg
ctgctcaaaagcgctgacgccagtctggcggacatgaatgaccccagcctgattaccgca
cgacgcgcgattactgacgatatcgccagcctgtcatccgttgcgcagatcgactacgac
ggcattattctcaagctcaatcagctctctaaccaaatcgataacctgcgtctggcggat
aacgataccgatggttcgccgatggattcagacagcagcgagctgtccagctcgttaagc
gaatggcgcgttaacctgcaaaaaagctggcagaactttatggacagctttattaccatt
cgccgccgcgatgataccgccgtaccgctgttggcacccaaccaggacgtctatttacgc
gaaaatattcgctcccgcctgttagtcgccgcgcaggccgtgccacgccatcaggaagaa
acataccgtcaggcgctggataacgtttcgacctgggttcgcgcttattacgatactgac
gacgccgcgacaaaagccttcctggaggaggtcgataaattaagccagcaaaatatcacg
atggatctgccagaaaccctgggaagccaggcgattcttgaaaaactgatgcaaacccgc
gtgcgtaatctgctggcgcaaccgacagtctctacggcagcgcctgccacgcagacagac
gctccggcagccgcgccgcaaggagaataa

DBGET integrated database retrieval system