KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM4476.SHelp
Entry
STM4476.S         CDS       T00065                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STM4476.S (holC)
   00240 Pyrimidine metabolism
    STM4476.S (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    STM4476.S (holC)
   03430 Mismatch repair
    STM4476.S (holC)
   03440 Homologous recombination
    STM4476.S (holC)
Enzymes [BR:stm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STM4476.S (holC)
DNA replication proteins [BR:stm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STM4476.S (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4719868..4720311)
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTVNGLSAVEQLVCEIAAERWRAGKRVLIACEDEKQAIRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTSFADFATAFTEVVDFVPYE
ETLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcgacgttctatcttctggataatgacaccaccgtcaacggtttaagcgcc
gttgaacaactggtgtgtgaaattgccgcagaacgttggcgcgcgggcaagcgcgtgctg
atcgcctgcgaagatgagaagcaggccattcggctggatgaagcgctgtgggcaagaccg
gcggaaagttttgtcccgcacaatctggcaggcgaaggcccacgcggcggcgcgccggtt
gaaatcgcctggccgcaaaaacgcaacagcagcccgcgcgatattttaatcagcctgcgt
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgtcccttacgaa
gaaactttgaaacaactggcgcgcgaacgctacaaagcctaccgcgtggctggttttaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system