KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM4476.SHelp
Entry
STM4476.S         CDS       T00065                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:stm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:stm00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:stm03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:stm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:stm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4719868..4720311)
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTVNGLSAVEQLVCEIAAERWRAGKRVLIACEDEKQAIRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTSFADFATAFTEVVDFVPYE
ETLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcgacgttctatcttctggataatgacaccaccgtcaacggtttaagcgcc
gttgaacaactggtgtgtgaaattgccgcagaacgttggcgcgcgggcaagcgcgtgctg
atcgcctgcgaagatgagaagcaggccattcggctggatgaagcgctgtgggcaagaccg
gcggaaagttttgtcccgcacaatctggcaggcgaaggcccacgcggcggcgcgccggtt
gaaatcgcctggccgcaaaaacgcaacagcagcccgcgcgatattttaatcagcctgcgt
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgtcccttacgaa
gaaactttgaaacaactggcgcgcgaacgctacaaagcctaccgcgtggctggttttaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system