KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM4557Help
Entry
STM4557           CDS       T00065                                 

Gene name
holD
Definition
(RefSeq) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00230  Purine metabolism
stm00240  Pyrimidine metabolism
stm01100  Metabolic pathways
stm03030  DNA replication
stm03430  Mismatch repair
stm03440  Homologous recombination
Module
stm_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STM4557 (holD)
   00240 Pyrimidine metabolism
    STM4557 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    STM4557 (holD)
   03430 Mismatch repair
    STM4557 (holD)
   03440 Homologous recombination
    STM4557 (holD)
Enzymes [BR:stm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STM4557 (holD)
DNA replication proteins [BR:stm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STM4557 (holD)
DNA repair and recombination proteins [BR:stm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     STM4557 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-GeneID: 1256083
NCBI-ProteinID: NP_463413
UniProt: Q8ZJW5
Position
4812287..4812724
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLTPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacctgcgctgaacgagccgctaatgcgcgatatcttacgcgcg
ttgaccgtgagtcccgatcaggttttaccgctgacgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system