KEGG   Streptococcus thermophilus ND03: STND_0063Help
Entry
STND_0063         CDS       T01978                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:stn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
67925..68515
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGTLVKITAKHIVIETNGLGYIVTVANPYSFSDQMNQTIQVYLHQVIRDDAHLLF
GFHTEDEKEVFLKLISVSGIGPTTALAIVAVDDNQGLVAAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFAELPAETTNTTANQTAGNQQLDEAMEALLALGYKATELKKVKAFFEDTN
ETAEQYIKSALKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattatatcaagggcaccctagtaaaaatcacagccaaacacattgtcatagaa
acaaatggtctaggatatattgtcactgtggctaatccctacagcttttctgatcaaatg
aatcagactatccaagtgtatcttcatcaagttattagagatgatgcccacctacttttt
ggttttcatactgaagatgagaaagaagtttttcttaagttgatttctgtttctgggata
ggtccgacgactgctctagccatagtggctgtggatgataatcagggacttgttgctgct
attgataatagtgacatcaaatacctgatgaaatttccaaagattggtaaaaagactgct
caacaaatggttcttgatctggcaggaaaatttgcagagttaccagcagaaacgaccaat
actacggcaaatcagactgcaggaaatcaacagttggatgaagctatggaagctttgctt
gctcttgggtacaaagccacagagcttaagaaagtgaaagccttctttgaggataccaat
gaaacggcagagcaatatattaagtccgctcttaaaatgttgatgaagtga

DBGET integrated database retrieval system