KEGG   Streptococcus thermophilus ND03: STND_0485Help
Entry
STND_0485         CDS       T01978                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stn  Streptococcus thermophilus ND03
Pathway
stn00010  Glycolysis / Gluconeogenesis
stn00051  Fructose and mannose metabolism
stn00562  Inositol phosphate metabolism
stn01100  Metabolic pathways
stn01110  Biosynthesis of secondary metabolites
stn01120  Microbial metabolism in diverse environments
stn01130  Biosynthesis of antibiotics
stn01200  Carbon metabolism
stn01230  Biosynthesis of amino acids
Module
stn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_0485
   00051 Fructose and mannose metabolism
    STND_0485
   00562 Inositol phosphate metabolism
    STND_0485
Enzymes [BR:stn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STND_0485
Exosome [BR:stn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STND_0485
  Exosomal proteins of bladder cancer cells
   STND_0485
  Exosomal proteins of melanoma cells
   STND_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADQ62550
Position
474216..474974
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSADLVEAGIAVPAVDLTTVIAAAKGSNL
KVAAQNTYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMIPIICCGESLETYEAGKAAEFVGAQVSAALAGLTPEQVASSVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVLYGGSVKPENVAEYMACPDVDGALVGGASLE
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagca
aaagcatttgttgaagctgtagcgtcaaaattgccttcagctgaccttgttgaagctggt
attgcggttcctgcagttgatttgacaactgttattgctgctgctaaaggttcaaacctt
aaagttgctgcacaaaacacttactttgaaaattcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactatgttgttatcggtcactcagaacgtcgt
gactacttccacgaaaccgatgaagacatcaacaaaaaagctaaggcaatctttgctaac
ggtatgattccaatcatctgttgtggtgaatcccttgaaacttacgaagctggtaaagca
gcagaattcgtaggtgctcaagtttcagctgctttagctggattgactcctgagcaagta
gcttcatcagttattgcgtacgaaccaatctgggctatcggtaccggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgtgcgtgatgttgtggcagctgacttcggt
caagaagtcgctgacaaagtacgtgttctatacggtggttcagttaaacctgaaaacgtt
gctgaatacatggcttgtccagatgttgacggagctcttgtaggtggtgcatcacttgaa
cctgaaagtttcttggcattgcttgacttcgttaaataa

DBGET integrated database retrieval system