KEGG   Streptococcus thermophilus ND03: STND_0485Help
Entry
STND_0485         CDS       T01978                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STND_0485
   01230 Biosynthesis of amino acids
    STND_0485
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_0485
   00051 Fructose and mannose metabolism
    STND_0485
   00562 Inositol phosphate metabolism
    STND_0485
Enzymes [BR:stn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STND_0485
Exosome [BR:stn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STND_0485
  Exosomal proteins of bladder cancer cells
   STND_0485
  Exosomal proteins of melanoma cells
   STND_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
474216..474974
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSADLVEAGIAVPAVDLTTVIAAAKGSNL
KVAAQNTYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMIPIICCGESLETYEAGKAAEFVGAQVSAALAGLTPEQVASSVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVLYGGSVKPENVAEYMACPDVDGALVGGASLE
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagca
aaagcatttgttgaagctgtagcgtcaaaattgccttcagctgaccttgttgaagctggt
attgcggttcctgcagttgatttgacaactgttattgctgctgctaaaggttcaaacctt
aaagttgctgcacaaaacacttactttgaaaattcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactatgttgttatcggtcactcagaacgtcgt
gactacttccacgaaaccgatgaagacatcaacaaaaaagctaaggcaatctttgctaac
ggtatgattccaatcatctgttgtggtgaatcccttgaaacttacgaagctggtaaagca
gcagaattcgtaggtgctcaagtttcagctgctttagctggattgactcctgagcaagta
gcttcatcagttattgcgtacgaaccaatctgggctatcggtaccggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgtgcgtgatgttgtggcagctgacttcggt
caagaagtcgctgacaaagtacgtgttctatacggtggttcagttaaacctgaaaacgtt
gctgaatacatggcttgtccagatgttgacggagctcttgtaggtggtgcatcacttgaa
cctgaaagtttcttggcattgcttgacttcgttaaataa

DBGET integrated database retrieval system