KEGG   Streptococcus thermophilus ND03: STND_0485Help
Entry
STND_0485         CDS       T01978                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STND_0485
   01230 Biosynthesis of amino acids
    STND_0485
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_0485
   00051 Fructose and mannose metabolism
    STND_0485
   00562 Inositol phosphate metabolism
    STND_0485
Enzymes [BR:stn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STND_0485
Exosome [BR:stn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STND_0485
  Exosomal proteins of bladder cancer cells
   STND_0485
  Exosomal proteins of melanoma cells
   STND_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
474216..474974
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSADLVEAGIAVPAVDLTTVIAAAKGSNL
KVAAQNTYFENSGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMIPIICCGESLETYEAGKAAEFVGAQVSAALAGLTPEQVASSVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVLYGGSVKPENVAEYMACPDVDGALVGGASLE
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagca
aaagcatttgttgaagctgtagcgtcaaaattgccttcagctgaccttgttgaagctggt
attgcggttcctgcagttgatttgacaactgttattgctgctgctaaaggttcaaacctt
aaagttgctgcacaaaacacttactttgaaaattcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactatgttgttatcggtcactcagaacgtcgt
gactacttccacgaaaccgatgaagacatcaacaaaaaagctaaggcaatctttgctaac
ggtatgattccaatcatctgttgtggtgaatcccttgaaacttacgaagctggtaaagca
gcagaattcgtaggtgctcaagtttcagctgctttagctggattgactcctgagcaagta
gcttcatcagttattgcgtacgaaccaatctgggctatcggtaccggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgtgcgtgatgttgtggcagctgacttcggt
caagaagtcgctgacaaagtacgtgttctatacggtggttcagttaaacctgaaaacgtt
gctgaatacatggcttgtccagatgttgacggagctcttgtaggtggtgcatcacttgaa
cctgaaagtttcttggcattgcttgacttcgttaaataa

DBGET integrated database retrieval system