KEGG   Streptococcus thermophilus ND03: STND_0522Help
Entry
STND_0522         CDS       T01978                                 

Definition
Aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    STND_0522
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STND_0522
Enzymes [BR:stn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     STND_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
503351..504277
Genome map
AA seq 308 aa AA seqDB search
MAIADGKVSLKHLVTMETLTNEEVLGMIRRGGDFKNGRADFQLDRQYFAANLFFENSTRT
HKSFEVAEKKLGLDVIEFDAGTSSVNKGETLYDTILTMSALGVDICVVRHSEVDYYKQLI
DSRTIQTSIVNGGDGSGQHPSQCLLDLMTIYEEFGTFGNLKICIAGDITHSRVAKSNMRI
LKRLGAQIYFAGPTEWYSSEFDVYGQHVAIDDVIEDLNVLMLLRVQHERHRNDKGFSKEE
YHTLYGLTEERYAKLADQAIIMHPAPVNRDVEIADSLVEAPKARIVTQMQNGVFVRMAII
EAILNGKA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgcagatgggaaagtgtcactaaaacatttggtgactatggaaaccctcacg
aatgaagaggtcttgggcatgattcgtcgaggtggagattttaaaaacggtagagctgat
ttccagctggatcgacagtatttcgctgccaatctcttttttgaaaattcaacacgaaca
cataagtcctttgaagtagctgagaaaaaacttggattggacgtgattgagtttgatgct
gggactagctcagtaaataagggtgaaaccctctatgatacgattttgacgatgtctgct
ttgggtgttgatatctgtgtggttcgccactcggaagtcgattactacaagcagttgatt
gacagtaggactattcagacttctattgttaatggtggtgacggttctgggcaacaccca
agtcagtgtttgcttgatttgatgacaatttatgaagagttcggaacttttggaaatcta
aagatttgtattgcaggcgatattacgcattcgcgtgtagctaagtcaaatatgcgaatt
ctcaagcgtttgggagcacagatttattttgctggccctacagagtggtattcaagtgag
tttgatgtttatggtcagcatgtggccattgacgacgtcattgaggacttgaatgtactc
atgttgcttcgtgttcagcacgaacgtcataggaatgacaaaggattttcaaaagaagag
taccatactctctatggtttgactgaagaacgttatgcaaagttagcagatcaagcaatc
attatgcacccagctccggttaatcgtgatgtggaaattgctgatagcttggttgaggca
cctaaggcacgtatcgttactcagatgcaaaatggagtctttgtccgtatggcgattatc
gaagctattttaaatggcaaagcgtaa

DBGET integrated database retrieval system