KEGG   Streptococcus thermophilus ND03: STND_0579Help
Entry
STND_0579         CDS       T01978                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
stn  Streptococcus thermophilus ND03
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:stn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:stn00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
558090..558593
Genome map
AA seq 167 aa AA seqDB search
MSKQIIAIWAEARNHVIGKNHTMPWHLPAELAHFKKTTMGSAILMGRVTFDGMNRRCLPG
RETLILTRDKDFDCEEVTTVTSVEEALAWFEQQDKDLYIAGGAGVYKAFDGHYDVLIKTT
IEADLEGDTYFPQLDTTAFKEVSRDRVPKNEKNAYDFSISRYEKERD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaacaaatcattgctatttgggcggaagctcgtaaccatgttattgggaagaat
cacaccatgccgtggcacttgcctgctgaactggcacatttcaagaaaacgaccatgggt
tcagcaattcttatgggacgtgtgacctttgatggcatgaaccgtcgttgcctcccagga
cgtgaaaccttaattctaacacgagacaaggacttcgactgtgaggaagtaacgaccgtt
acaagtgttgaggaagctctagcttggtttgaacagcaagataaggatctctatattgct
ggtggtgctggtgtctacaaggcttttgatggacattatgatgtgctcatcaaaacaact
attgaggctgatttagagggagacacatattttccacaactagatacgacggcatttaaa
gaggtatcgcgtgaccgcgtgcccaagaatgaaaaaaatgcctatgactttagtataagt
cgctatgaaaaagaaagggactag

DBGET integrated database retrieval system