KEGG   Streptococcus thermophilus ND03: STND_0614Help
Entry
STND_0614         CDS       T01978                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
stn  Streptococcus thermophilus ND03
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:stn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
593304..593900
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFSKFPGIGAKTATRLAFYTISMSDEDVNDFAKNLLAAKRELTYCSVC
GRLTDDDPCIICTDETRDRTKILVVEDSKDVSAMEKIQEYRGLYHVLQGLISPMNGVGPD
DINLKSLITRLMDSEVDEVIIATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatcctactccaattgctaaactgattgatagtttttcaaaatttccaggaatt
ggggctaagacggcgacacgtctggctttctataccattagcatgtctgatgaagatgtc
aatgattttgcaaaaaatcttttagcagcaaaacgtgagttgacctattgttcagtttgt
ggtcgcttgactgatgatgacccatgtattatttgtacggatgaaactagagaccgtact
aagattttggttgttgaggactccaaagatgtttctgctatggaaaagattcaggaatat
cgtggtctctaccatgtgcttcaagggcttatctcccctatgaatggtgttggaccagat
gatattaatttaaaaagtttgattacccgtcttatggatagcgaggttgacgaggtcatc
atcgcaactaatgcaacggccgatggtgaggcaacctctatgtatatttcacgggtcctc
aaacctgcaggtattaaggtgacccgcctagcgcgtgggctggctgttggttctgacatc
gagtacgctgatgaagtaaccttgctaagagccatcgagaatcgaacagaactgtag

DBGET integrated database retrieval system