KEGG   Streptococcus thermophilus ND03: STND_0717Help
Entry
STND_0717         CDS       T01978                                 

Definition
(GenBank) Glucokinase GlcK
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
stn  Streptococcus thermophilus ND03
Pathway
stn00010  Glycolysis / Gluconeogenesis
stn00052  Galactose metabolism
stn00500  Starch and sucrose metabolism
stn00520  Amino sugar and nucleotide sugar metabolism
stn00521  Streptomycin biosynthesis
stn01100  Metabolic pathways
stn01110  Biosynthesis of secondary metabolites
stn01120  Microbial metabolism in diverse environments
stn01130  Biosynthesis of antibiotics
stn01200  Carbon metabolism
Module
stn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
stn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_0717
   00052 Galactose metabolism
    STND_0717
   00500 Starch and sucrose metabolism
    STND_0717
   00520 Amino sugar and nucleotide sugar metabolism
    STND_0717
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STND_0717
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    STND_0717
Enzymes [BR:stn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     STND_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ADQ62776
Position
690566..691534
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTVKFGILTADGEVQEKWAIETNTFENGSHIVPDIVESLKHRLELYGL
TAEDFIGIGMGSPGAVDRENKTVTGAFNLNWAETQEVGSVIEKELGIPFAIDNDANVAAL
GERWVGAGANNRNVVFITLGTGVGGGVIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NKGCLETVASATGIVRVAHHLAEKYEGNSSIKAAVDNGEFVTSKDIIVAATEGDKFADSI
VDKVSKYLGLATANISNILNPDSVVIGGGVSAAGEFLRSRVEGYFTRYAFPQVRRTTKVK
LAELGNDAGIIGAASLAYSIDK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaactcttaggtattgaccttggtggaacaactgttaagtttggtattttg
actgcagatggtgaagttcaagaaaaatgggctattgaaacaaatacgtttgaaaatggt
agccacattgttcctgacattgtagaatctttgaaacaccgtttggaattgtatggactt
actgctgaagattttattggaattggtatgggatctccaggtgcagttgaccgagaaaat
aaaacagtaacgggtgcctttaacttgaactgggcagaaactcaagaagttggctctgtt
attgaaaaagaacttggtattccattcgctattgataatgatgctaatgtggctgcactg
ggtgaacgttgggttggtgctggtgctaacaatcggaatgttgtctttataacattgggt
acaggtgttggtggcggtgttatcgctgatggtaacttaattcatggtgttgccggtgct
ggtggggaaattggtcacattattgttgaacctgacacaggatttgagtgtacttgcgga
aacaaggggtgtctggaaactgtagcttcagcaacaggtattgtacgtgtagcacatcat
ttggcagaaaaatacgaaggaaactcttctattaaagctgctgtagacaatggtgagttt
gtgacaagtaaagatattatcgtagctgctactgaaggtgataagtttgctgacagcatt
gttgataaagtctctaaatacctcggacttgcaacagcaaacatctcaaacattcttaac
ccagattctgtcgttatcggtggtggtgtttctgccgcaggagaattcttgcgtagtcgt
gttgaaggatactttacacgttatgcattcccacaagttcgccgtacaacaaaagtgaaa
ttagcggagcttggaaatgatgcaggaatcattggagctgctagtcttgcttatagtatt
gacaaataa

DBGET integrated database retrieval system