KEGG   Streptococcus thermophilus ND03: STND_0858Help
Entry
STND_0858         CDS       T01978                                 

Definition
alcohol dehydrogenase I
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STND_0858
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_0858
  Lipid metabolism
   00071 Fatty acid degradation
    STND_0858
  Amino acid metabolism
   00350 Tyrosine metabolism
    STND_0858
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STND_0858
   00626 Naphthalene degradation
    STND_0858
Enzymes [BR:stn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STND_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
816039..816383
Genome map
AA seq 114 aa AA seqDB search
MRAVVVNQASTGIEVVDYEKPALVAHGQALVKVEYCGVWHTDLHVAHGDFGQVPGHILGH
ERIGIVEEVGEGVKTLKKGDRVSIAWFFKGWCGYYEYCTTGRETLCRSVKKCWL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttgttgttaatcaagcaagcacaggtattgaagttgtggactatgaaaaa
ccagcgttagttgctcatggtcaagccttggttaaagttgaatactgtggcgtttggcat
actgaccttcatgtagcccatggagactttggtcaagttccaggtcatatcttaggccat
gagagaattggtattgttgaagaagttggtgaaggggttaaaacactaaaaaaaggtgat
cgcgtatcaatcgcttggttcttcaaagggtggtgtggctactatgaatattgtacaact
ggacgtgaaacactctgtcggtctgtaaaaaaatgctggttatag

DBGET integrated database retrieval system