KEGG   Streptococcus thermophilus ND03: STND_0858Help
Entry
STND_0858         CDS       T01978                                 

Definition
alcohol dehydrogenase I
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STND_0858
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_0858
  Lipid metabolism
   00071 Fatty acid degradation
    STND_0858
  Amino acid metabolism
   00350 Tyrosine metabolism
    STND_0858
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STND_0858
   00626 Naphthalene degradation
    STND_0858
Enzymes [BR:stn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STND_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816039..816383
Genome map
AA seq 114 aa AA seqDB search
MRAVVVNQASTGIEVVDYEKPALVAHGQALVKVEYCGVWHTDLHVAHGDFGQVPGHILGH
ERIGIVEEVGEGVKTLKKGDRVSIAWFFKGWCGYYEYCTTGRETLCRSVKKCWL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttgttgttaatcaagcaagcacaggtattgaagttgtggactatgaaaaa
ccagcgttagttgctcatggtcaagccttggttaaagttgaatactgtggcgtttggcat
actgaccttcatgtagcccatggagactttggtcaagttccaggtcatatcttaggccat
gagagaattggtattgttgaagaagttggtgaaggggttaaaacactaaaaaaaggtgat
cgcgtatcaatcgcttggttcttcaaagggtggtgtggctactatgaatattgtacaact
ggacgtgaaacactctgtcggtctgtaaaaaaatgctggttatag

DBGET integrated database retrieval system