KEGG   Streptococcus thermophilus ND03: STND_0859Help
Entry
STND_0859         CDS       T01978                                 

Definition
(RefSeq) Alcohol dehydrogenase, propanol-preferring
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STND_0859
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_0859
  Lipid metabolism
   00071 Fatty acid degradation
    STND_0859
  Amino acid metabolism
   00350 Tyrosine metabolism
    STND_0859
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STND_0859
   00626 Naphthalene degradation
    STND_0859
Enzymes [BR:stn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STND_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
816397..817044
Genome map
AA seq 215 aa AA seqDB search
MSDYALVTADYAVKVPDGLNPAQASSITCAGVTTYKAIKEAKVEPGQWVAIYGAGGLGNL
AIQYAKKVFNTRVVAVDINQDKLYLAKESGADLVVNGKEVEDVAGYIQEKTGGTHSAVVT
AVYKVAFNQAVDRVRAVGLPSEYMDLSIVKTVLDGIHVVGSLVGTRKDLEEAFDFGAQGL
VVPVVETVPVDTAVKVFDQMEKGKIQGRKVLDFTK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactatgctttggttactgctgactacgctgtgaaagttccagacggactcaat
cccgctcaagcttcatctattacttgtgcgggagttacaacttataaagccattaaagag
gctaaagttgaacctggtcaatgggtagctatttatggtgctggagggctaggtaatttg
gctattcaatatgctaagaaagtttttaacacacgagtagtagcagttgatatcaatcaa
gataaactatatttggctaaagaatctggcgctgatttagtggtaaatggtaaagaagtt
gaagatgtagcaggctatatccaagagaaaactggtggtacacacagtgctgttgtaaca
gctgtttataaggttgctttcaaccaggctgtcgatagagtacgtgccgttgggctccca
tctgaatacatggatctctcaattgtcaaaacagttctagatggtatccatgttgttgga
tctcttgtaggtacgcgtaaagacttagaagaagcttttgacttcggtgcacaaggcttg
gtagtaccagttgttgaaaccgttcctgtcgatacagctgtaaaagtatttgatcaaatg
gaaaaaggtaaaattcaaggacgtaaggtacttgatttcactaagtaa

DBGET integrated database retrieval system