KEGG   Streptococcus thermophilus ND03: STND_1000Help
Entry
STND_1000         CDS       T01978                                 

Definition
Beta-glucosidase, putative
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_1000
Enzymes [BR:stn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     STND_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(950026..950844)
Genome map
AA seq 272 aa AA seqDB search
MAKYNIEPLVTLSHYEMPLNLAREYNGWTNRKIIGFYENYVRTFFKRYKDKVKYWLTFNE
VNSVLHAPFMLGGIATPMEGLSKQELYQAVHHELVGSASITKIGHEIKPEFKNGCMVLAM
PAYGMTATPLDQLAVPEFENQNYLFSDIHARGKYPNYIKYYFKDNGIEIQFSPGDDEILK
NTVNFISFSYAMSEATAHNPEDYKVVKGNILGGVENPYLEKSEWGWAIDPIGLRLVLDDF
YDRYQLPLFIVENGPDGPTVEDDYRMITFKNT
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttggctaagtataatatcgaacctctggtcaccttgtctcactatgaaatgcccctaaac
ttggcacgtgagtacaacggatggactaatcgtaaaataattggattttatgagaattat
gttcgtacgttctttaaacgctataaagataaggtcaaatattggttgacctttaatgaa
gtgaactctgttctacatgcaccgtttatgttaggtggtattgcaactcctatggaaggg
ctatctaaacaagaactctaccaagctgttcaccacgagttggtcggttcagcttcaata
actaagattggccatgaaattaagcctgagtttaaaaacggttgtatggttcttgccatg
cctgcgtacgggatgacagctactccattggatcagttggcagttcctgagtttgaaaat
caaaactatctcttctctgatattcatgcacgtggaaaatatccgaactatattaaatat
tacttcaaagataatggtattgaaatacaattttcccctggcgacgatgaaatcttaaag
aataccgttaattttatttcattctcttatgctatgtctgaagcaacagcacacaaccca
gaagactataaggttgttaaaggcaacatcttaggtggtgtcgaaaatccataccttgag
aaatctgaatggggctgggctattgatccaattggacttcgtttggttttagatgacttt
tatgatcgttatcaattgccattgtttattgtcgaaaatggtcctgatggtccgacagtt
gaggatgattatcgtatgattaccttcaaaaacacttga

DBGET integrated database retrieval system