KEGG   Streptococcus thermophilus ND03: STND_1142Help
Entry
STND_1142         CDS       T01978                                 

Definition
(RefSeq) Phosphoglycerate mutase 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STND_1142
   01230 Biosynthesis of amino acids
    STND_1142
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_1142
  Energy metabolism
   00680 Methane metabolism
    STND_1142
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STND_1142
Enzymes [BR:stn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     STND_1142
Exosome [BR:stn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   STND_1142
  Exosomal proteins of melanoma cells
   STND_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1071018..1071710)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDKAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPKMDRDDEYSAHKDSRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKKLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtctgaatggaacaaagctaatcttttc
acaggttgggctgacgtagatctttctgaaaaaggtactcaacaagctattgacgctggt
aaattgattaaagaagctggtattgaatttgacaaagcttacacttcagtattgaaacgt
gcgatcaaaacaactaaccttgcgcttgaagcctctgaccaactttgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaataaagcagaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaaaatggaccgtgatgatgagtactcagcacacaaagacagtcgttacgcttca
cttgacgattcagtaattccagatgctgaaaacttgaaagtaactttggaacgtgccctt
ccattctgggaagataaaattgctccagctcttaaagatggtaaaaacgtattcgtaggt
gcacatggtaactcaatccgtgcccttgtaaaacacatcaaaaaattgtcagatgacgaa
atcatggatgttgaaattccaaacttcccaccattggtatttgaatttgacgaaaaattg
aacgttgtttctgaatattacctcggaaaataa

DBGET integrated database retrieval system