KEGG   Streptococcus thermophilus ND03: STND_1204Help
Entry
STND_1204         CDS       T01978                                 

Definition
Mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STND_1204
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STND_1204
Enzymes [BR:stn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     STND_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1120959..1122284
Genome map
AA seq 441 aa AA seqDB search
MGILAGKASHFVLSKLGRGSTLPGKIALKFDKDILDTLAKDYEIVVVTGTNGKTLTTALT
VGILKEAYGEIVTNPSGANMITGITSTFLTAKRAKSGKKIAVLEIDEASLPKITEYITPS
LFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPAATILANGDSPLFNSKELVNPVRFYGF
DTEKHAPELTHYNTEGIVCPKCENILQYHLNTYANLGDYVCLNCDFHRPELDYKLTQLTK
ITNTTSEFIIDGQDYKINVGGLYNIYNALAAVSVAEFFGVVPEQIKAGFDKSRAVFGRQE
TFKIGDKSCTLVLIKNPVGASQALDMIKLADHPFSLSVLLNANYADGIDTSWIWDANFES
ILDMDIPEINAGGVRHSEIARRLRVTGYPEDKITQAEKLEDIMTLIEKQDCDHAYILATY
TAMLEFRDILAQRHAVGKGMN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcttggcaggtaaagctagtcactttgttctctcaaaattgggacgtggctca
accctcccaggaaaaatcgcccttaaatttgataaagatattttagacacactagctaaa
gattatgaaatcgtcgttgtcactggtaccaacggtaagactctgacaaccgctttgaca
gtcggtattctaaaagaagcttacggtgaaattgtaactaaccctagtggagccaacatg
atcactgggattacttccacctttctaactgctaaaagagctaaatctggtaagaaaatc
gctgtcttggagattgatgaagccagccttccaaaaatcactgagtatatcactccaagt
ctttttgtcttcacaaatattttccgtgaccaaatggaccgttatggtgaaatttacacc
acttatcagatgattttagatggtgctgctaaggcgccagcggcaactattttggctaac
ggggacagtcctctttttaattctaaagagctagtcaatcccgtacgtttctatggtttt
gacactgaaaaacatgcgccagagcttacacactataatactgaaggaattgtgtgtcct
aagtgcgagaacattcttcagtatcaccttaatacttacgctaacttaggtgactatgtg
tgccttaactgtgactttcaccgtccagaattagattataagctaacgcagctgacaaaa
atcaccaacaccacttctgaatttatcattgacggtcaagattacaagattaacgttggg
gggctctacaacatctataatgcccttgctgccgtttctgtcgctgaattcttcggcgtt
gtgccagagcaaatcaaagctggttttgataagagtcgtgctgtctttggacgtcaagaa
acctttaaaattggtgataaatcatgtactctcgtactgattaagaatccagttggagct
agccaagctctggatatgattaaacttgcagaccatccatttagcttgtcagtccttctt
aatgccaactatgctgatggtattgacaccagctggatttgggatgccaactttgaaagc
attctcgatatggatattcctgaaattaatgctggtggtgtccgtcactctgaaattgcc
cgtcgtctgcgtgtaactggctatccagaggacaaaattacacaagcagaaaaactcgaa
gatattatgaccctgattgaaaagcaagactgcgaccacgcctatatcttagcgacctat
actgccatgcttgaattccgtgatattctggcccaacgtcatgctgtcggaaaggggatg
aactaa

DBGET integrated database retrieval system