KEGG   Streptococcus thermophilus ND03: STND_1204Help
Entry
STND_1204         CDS       T01978                                 

Definition
Mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:stn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:stn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1120959..1122284
Genome map
AA seq 441 aa AA seqDB search
MGILAGKASHFVLSKLGRGSTLPGKIALKFDKDILDTLAKDYEIVVVTGTNGKTLTTALT
VGILKEAYGEIVTNPSGANMITGITSTFLTAKRAKSGKKIAVLEIDEASLPKITEYITPS
LFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPAATILANGDSPLFNSKELVNPVRFYGF
DTEKHAPELTHYNTEGIVCPKCENILQYHLNTYANLGDYVCLNCDFHRPELDYKLTQLTK
ITNTTSEFIIDGQDYKINVGGLYNIYNALAAVSVAEFFGVVPEQIKAGFDKSRAVFGRQE
TFKIGDKSCTLVLIKNPVGASQALDMIKLADHPFSLSVLLNANYADGIDTSWIWDANFES
ILDMDIPEINAGGVRHSEIARRLRVTGYPEDKITQAEKLEDIMTLIEKQDCDHAYILATY
TAMLEFRDILAQRHAVGKGMN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcttggcaggtaaagctagtcactttgttctctcaaaattgggacgtggctca
accctcccaggaaaaatcgcccttaaatttgataaagatattttagacacactagctaaa
gattatgaaatcgtcgttgtcactggtaccaacggtaagactctgacaaccgctttgaca
gtcggtattctaaaagaagcttacggtgaaattgtaactaaccctagtggagccaacatg
atcactgggattacttccacctttctaactgctaaaagagctaaatctggtaagaaaatc
gctgtcttggagattgatgaagccagccttccaaaaatcactgagtatatcactccaagt
ctttttgtcttcacaaatattttccgtgaccaaatggaccgttatggtgaaatttacacc
acttatcagatgattttagatggtgctgctaaggcgccagcggcaactattttggctaac
ggggacagtcctctttttaattctaaagagctagtcaatcccgtacgtttctatggtttt
gacactgaaaaacatgcgccagagcttacacactataatactgaaggaattgtgtgtcct
aagtgcgagaacattcttcagtatcaccttaatacttacgctaacttaggtgactatgtg
tgccttaactgtgactttcaccgtccagaattagattataagctaacgcagctgacaaaa
atcaccaacaccacttctgaatttatcattgacggtcaagattacaagattaacgttggg
gggctctacaacatctataatgcccttgctgccgtttctgtcgctgaattcttcggcgtt
gtgccagagcaaatcaaagctggttttgataagagtcgtgctgtctttggacgtcaagaa
acctttaaaattggtgataaatcatgtactctcgtactgattaagaatccagttggagct
agccaagctctggatatgattaaacttgcagaccatccatttagcttgtcagtccttctt
aatgccaactatgctgatggtattgacaccagctggatttgggatgccaactttgaaagc
attctcgatatggatattcctgaaattaatgctggtggtgtccgtcactctgaaattgcc
cgtcgtctgcgtgtaactggctatccagaggacaaaattacacaagcagaaaaactcgaa
gatattatgaccctgattgaaaagcaagactgcgaccacgcctatatcttagcgacctat
actgccatgcttgaattccgtgatattctggcccaacgtcatgctgtcggaaaggggatg
aactaa

DBGET integrated database retrieval system