KEGG   Streptococcus thermophilus ND03: STND_1473Help
Entry
STND_1473         CDS       T01978                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STND_1473
Enzymes [BR:stn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     STND_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1388954..1389445)
Genome map
AA seq 163 aa AA seqDB search
MTKVYLSLGSNMGNRQDYLKKAVESLDRLLETEVKAVSSYYETAAWGLTDQADFLNLALA
LDTQLPAESLLSACQAIEKDLDRVRHEHWGPRTVDIDILLYGQEIWGTEHLKVPHPLMTQ
RAFVLVPLLEIAENLVEPQTGQAYKKYLSQIDTSDVRKLEQVD
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtttatttaagtttgggatctaatatgggaaatcgtcaagactatcttaaa
aaagcggtggagtcattggatcgcttgcttgagacggaagttaaagcagtgtcctcttat
tatgagacggctgcttggggattaactgaccaggctgattttttgaatctcgctttagca
cttgacactcagttgccggctgaaagcttgctgagtgcttgtcaggcaattgagaaagat
ttagaccgcgttcgccatgagcattggggccctcgaactgtggatattgatattctttta
tatgggcaggaaatctgggggactgagcaccttaaagtgcctcatcctctcatgactcaa
agggcctttgttttggttcctctgctagaaattgccgagaatttagttgagcctcaaact
ggtcaagcctacaaaaaatatttgagtcaaatagacactagtgatgtccgcaaattggag
caagtggactag

DBGET integrated database retrieval system