KEGG   Streptococcus thermophilus ND03: STND_1476Help
Entry
STND_1476         CDS       T01978                                 

Definition
Dihydropteroate synthase-like protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STND_1476
Enzymes [BR:stn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     STND_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1391505..1392305)
Genome map
AA seq 266 aa AA seqDB search
MFIGKHEIAGKACIMGILNVTPDSFSDGGDFDTIEDALAQVERMISQGASIIDVGGESTR
PGAEFVTEEEEIARIVPIIQAIKEKYDVLISIDTYKTATARAALEAGADILNDVWAGLYD
GQMLALSAEKNVPIILMHNQKEEKYNDVTENVCTFLSQRTQAALEAGVAKENIWIDPGFG
FAKNVQHNIDLLRGLDKVVGLGYPVLFGISRKRVVDFLLGGNIPAKDRDQGTAALSAYAV
SKGCQIVRVHNVEANRDVVKTISGIL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtttattggtaaacatgaaattgcaggtaaggcctgcattatgggaatcttgaatgtt
accccagactctttctcagacggtggggattttgacacaattgaagatgcattagcccag
gttgagcgtatgatttcccaaggggctagcattatcgatgtaggtggtgaatctacaaga
cctggagcggaatttgtaaccgaggaagaagagattgctcgtatagtgccaattatacaa
gctattaaggaaaaatatgatgttcttatcagtattgatacttacaagacagccactgcc
agagctgctcttgaagcaggtgcagatattcttaatgatgtctgggcaggactttatgat
ggtcagatgctagccttatcagctgaaaaaaatgtaccgattatcctcatgcataatcaa
aaagaagaaaaatacaatgatgtcacagagaatgtctgtactttccttagtcaacgtacg
caagctgccttggaagcaggtgtagctaaagaaaatatttggattgatcctggctttggt
tttgccaagaatgttcaacacaatattgacctgcttaggggcttggacaaagttgttgga
cttgggtatcctgttctttttgggatttctcgtaagcgtgttgtggattttctcctaggt
ggaaatattcctgccaaggaccgtgatcaagggacagctgctttatctgcttatgctgtt
agcaaaggatgtcagattgtccgtgtccataatgttgaagccaatcgtgatgtcgttaag
actatctcaggaattttatga

DBGET integrated database retrieval system