KEGG   Streptococcus thermophilus ND03: STND_1494Help
Entry
STND_1494         CDS       T01978                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:stn00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:stn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1409092..1410354)
Genome map
AA seq 420 aa AA seqDB search
MRKIIINGGKKLQGEVTVSGAKNSVVALIPAIILSDGVVTLDGVPAISDVDNLIEIIEVM
GGSVKRDGETLEIDPRGVKDMPMPFSKINSLRASYYFYGSLLGRYGQAIVGLPGGCDLGP
RPIDLHLKAFEAMGASIFYEDEAMRIATDAGQRIKGAHIYMDTVSVGATINTMLAAAKAD
GRTVIENAAREPEIIDVATLLNNMGARVRGAGTEVITIEGVESLHGTRHQVIPDRIEAGS
YIAMAAAIGKGIKIKNVLYEHLESFICKLEAMGVRMTVEEDAIFVEEQGDLKPVDIKTSP
YPGFATDLQQPMTPLLLKASGRGKIIDTIYEKRVNHVPELARMGADIQVLGGQIVYNGPT
QLSGAPVKASDLRAGAALVTAGLMADGQTEITNIEFILRGYSNIIEKLSDLGADIRLIED
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaattatcatcaatggtggtaagaaacttcaaggagaagttacagtatcagga
gctaaaaattcagttgttgcattgattccagccatcattttatctgatggagtggttact
cttgacggggtaccagcaatcagcgacgtcgataatctaattgagattattgaagtaatg
ggtggttctgttaagcgtgatggcgaaacacttgaaatcgaccctcgaggcgttaaagat
atgccaatgccatttagtaagattaacagccttcgtgcttcatattatttctatggtagt
ttgcttgggcgttatggtcaagctatagtaggtttgcctggtggatgtgatttaggaccg
cgtcctattgaccttcaccttaaggcctttgaagctatgggtgctagcattttctatgaa
gatgaagctatgcgtattgctacggatgccggccaacgtatcaagggtgctcacatctat
atggatacggttagtgtgggggcgactatcaataccatgttggcagcggctaaggctgac
ggtcgtactgttattgaaaatgcggctcgtgaacctgagattattgatgtggcaacgctt
ctcaacaatatgggtgcgcgtgtacgtggcgctggtacagaagtcatcacgattgagggt
gtagagagcctacatggtactcgccatcaagttattccagaccgtattgaagcaggctca
tacattgccatggcggcagctatcggtaagggaattaaaattaaaaatgttctctatgaa
caccttgaaagttttatttgtaagcttgaagcaatgggtgttcgcatgaccgttgaagag
gatgcaatctttgtggaagaacagggtgatttaaaacctgttgacattaagacatcacct
tatccaggttttgcgacggatttacaacaaccaatgacaccattgttgttgaaagcaagt
ggccgaggaaaaatcattgatacgatctatgagaagcgtgtaaatcacgttcctgaactg
gctcgtatgggtgctgatattcaagtacttggtggtcagattgtttataatggtccaacg
caactttctggtgcacctgtgaaagctagtgatttgcgtgcgggtgctgcactcgttact
gcaggacttatggcagatggtcagactgaaataacaaacattgaatttatccttcggggg
tattcaaatatcattgagaaactttctgatcttggtgcggatattcgtttgattgaagat
taa

DBGET integrated database retrieval system