KEGG   Streptococcus thermophilus ND03: STND_1521Help
Entry
STND_1521         CDS       T01978                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STND_1521
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STND_1521
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STND_1521
Enzymes [BR:stn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STND_1521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1436995..1437777)
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLQAIKDSKRGIFVPYIMAGDHAKGLDGLFETITLLENSGVSAIEVGIPWSDP
VADGPIIELAGQRSLAKDVTLTAIIKKLQEKKTQVPLVIMTYINPVYQYGIEAFVKDLAE
TSVKGLIIPDLPNEHADFITPYLRDSDIALVPLVSLTTGIDRQKQLIDGAEGFIYAVAIN
GVTGKTGNYRDDLDKHLSNLTAYADIPVLTGFGVSTEEDIKRFNAVSDGVIVGSKIVRDL
HDGKEEEVAEFVTLGSHFEK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacactaacaaaacatctacaagctatcaaagacagtaaacgcggtattttc
gtgccctatatcatggctggtgaccacgctaaaggtctagacggactctttgagactatt
actctcttagaaaatagcggtgtttcagctatcgaggtgggtattccatggtctgaccca
gtggctgatggtcccattattgaactagcaggacaacgtagtttggctaaagacgtgact
ttaacagctatcatcaagaagcttcaagaaaaaaagacacaggtgcctttggttatcatg
acctacatcaacccagtttatcagtatggtattgaagcctttgtcaaagatttagcagag
acttctgtcaaggggctcatcattcctgatttgccaaatgaacatgctgactttatcact
ccttatttgagagacagtgacattgctctcgtgcctttggtcagcttgactacaggcatt
gatcgtcagaaacagttgattgatggtgcagaaggctttatctacgccgttgccatcaat
ggtgttactggtaagactggtaattaccgtgatgaccttgataaacacttatctaacttg
actgcctatgcagacattccagttctcacaggttttggtgtgtcaacagaggaagacatt
aaacgctttaatgctgtgtcagacggtgttatcgtgggatcaaaaattgtccgtgacctg
cacgacggtaaggaagaagaagtcgctgaatttgttacattaggttcacattttgaaaaa
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system