KEGG   Streptococcus thermophilus ND03: STND_1522Help
Entry
STND_1522         CDS       T01978                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stn  Streptococcus thermophilus ND03
Pathway
stn00260  Glycine, serine and threonine metabolism
stn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stn01100  Metabolic pathways
stn01110  Biosynthesis of secondary metabolites
stn01130  Biosynthesis of antibiotics
stn01230  Biosynthesis of amino acids
Module
stn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STND_1522
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STND_1522
Enzymes [BR:stn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STND_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADQ63558
Position
complement(1437781..1438989)
Genome map
AA seq 402 aa AA seqDB search
MTYQQPDAKGFYGKFGGQFVPETLMTAVIELDKAYREAKEDSSFQAELDDLLKNYVGRET
PLYHAKRLTDYIGGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGGKLPDAVMACIGGGS
NAIGMFYPFVNDKSVAMYGAEASGLGLDTEKHAATFAKGRPGILHGALMDVLQDAHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALEGFKLLSRLEGIIPALESSHAI
ALAQKVAAKMSPDQSLIVCLSGRGDKDVMQVKERFEAEAEGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaacaacctgatgcaaaaggattttacggaaaattcggcggtcagttcgtt
cccgaaacgctgatgacagccgttattgaattggataaggcctatcgtgaagccaaagaa
gattcaagtttccaagcggaattggatgacctccttaaaaactatgtgggccgtgaaaca
cctctttaccacgccaaacgtttgacagattatatcggtggagcgcaaatttaccttaaa
cgtgaagaccttaaccacacaggggcccacaagattaacaatgccctcggtcaagtcttg
cttgctaaacgtatgggtaagaagaaaatcatcgccgaaactggtgcaggtcaacacggt
gtcgcaacagcaacagccgctgctcttttcgacatggactgtaccatctatatgggtgag
gaagatgtgaaacgtcaggcgcttaacgttttccgtatggagttgcttggtgccaaagtt
ttcagtgttaccgatggatcacgagtgcttaaggacgctgtaaatgctgctcttcgtgct
tgggttgcaggtatcgaggatactcactacatcatgggatctgcccttggtccagcacca
ttcccagaaattgttcgtgatttccaatctgttatcggtcgtgaagccaaacgccaatat
gcagagatttctggcgggaaactgcctgatgctgtaatggcttgtatcggtggtggttca
aatgctatcggcatgttctacccatttgtcaatgataaatcagtagctatgtatggtgct
gaggcatctggtttgggacttgatactgaaaaacacgccgcaacctttgccaaaggtcgc
ccaggtatccttcatggagcgcttatggatgtcctccaagatgctcatggtcaaataatg
gaagctttctctatctcagctggtctggactacccaggggttggtcctgagcactgttat
ttcaacgaaataggacgtgcgacttacgactctatcacagatgaagaagcgctagaagga
ttcaaacttctgtcacgtttggaaggtattatcccagctcttgagtctagccatgccatt
gcgcttgcacaaaaagtggcagctaagatgtcgccagaccaaagcctcatcgtctgcctc
tcaggtcgtggggataaggacgttatgcaggttaaagaacgttttgaagctgaagcagaa
gggaaataa

DBGET integrated database retrieval system