KEGG   Streptococcus thermophilus ND03: STND_1522Help
Entry
STND_1522         CDS       T01978                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STND_1522
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STND_1522
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STND_1522
Enzymes [BR:stn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STND_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1437781..1438989)
Genome map
AA seq 402 aa AA seqDB search
MTYQQPDAKGFYGKFGGQFVPETLMTAVIELDKAYREAKEDSSFQAELDDLLKNYVGRET
PLYHAKRLTDYIGGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGGKLPDAVMACIGGGS
NAIGMFYPFVNDKSVAMYGAEASGLGLDTEKHAATFAKGRPGILHGALMDVLQDAHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALEGFKLLSRLEGIIPALESSHAI
ALAQKVAAKMSPDQSLIVCLSGRGDKDVMQVKERFEAEAEGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaacaacctgatgcaaaaggattttacggaaaattcggcggtcagttcgtt
cccgaaacgctgatgacagccgttattgaattggataaggcctatcgtgaagccaaagaa
gattcaagtttccaagcggaattggatgacctccttaaaaactatgtgggccgtgaaaca
cctctttaccacgccaaacgtttgacagattatatcggtggagcgcaaatttaccttaaa
cgtgaagaccttaaccacacaggggcccacaagattaacaatgccctcggtcaagtcttg
cttgctaaacgtatgggtaagaagaaaatcatcgccgaaactggtgcaggtcaacacggt
gtcgcaacagcaacagccgctgctcttttcgacatggactgtaccatctatatgggtgag
gaagatgtgaaacgtcaggcgcttaacgttttccgtatggagttgcttggtgccaaagtt
ttcagtgttaccgatggatcacgagtgcttaaggacgctgtaaatgctgctcttcgtgct
tgggttgcaggtatcgaggatactcactacatcatgggatctgcccttggtccagcacca
ttcccagaaattgttcgtgatttccaatctgttatcggtcgtgaagccaaacgccaatat
gcagagatttctggcgggaaactgcctgatgctgtaatggcttgtatcggtggtggttca
aatgctatcggcatgttctacccatttgtcaatgataaatcagtagctatgtatggtgct
gaggcatctggtttgggacttgatactgaaaaacacgccgcaacctttgccaaaggtcgc
ccaggtatccttcatggagcgcttatggatgtcctccaagatgctcatggtcaaataatg
gaagctttctctatctcagctggtctggactacccaggggttggtcctgagcactgttat
ttcaacgaaataggacgtgcgacttacgactctatcacagatgaagaagcgctagaagga
ttcaaacttctgtcacgtttggaaggtattatcccagctcttgagtctagccatgccatt
gcgcttgcacaaaaagtggcagctaagatgtcgccagaccaaagcctcatcgtctgcctc
tcaggtcgtggggataaggacgttatgcaggttaaagaacgttttgaagctgaagcagaa
gggaaataa

DBGET integrated database retrieval system