KEGG   Streptococcus thermophilus ND03: STND_1524Help
Entry
STND_1524         CDS       T01978                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
stn  Streptococcus thermophilus ND03
Pathway
stn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stn01100  Metabolic pathways
stn01110  Biosynthesis of secondary metabolites
stn01130  Biosynthesis of antibiotics
stn01230  Biosynthesis of amino acids
Module
stn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STND_1524
Enzymes [BR:stn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     STND_1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Tox-MPTase4
Motif
Other DBs
NCBI-ProteinID: ADQ63560
Position
complement(1439554..1440321)
Genome map
AA seq 255 aa AA seqDB search
MSKAFLPTILEQKEKEVAQLVMEDLQPLRQTYRLYDFLKSNQNKLQIISEVKKASPSMGD
INLDVDIVAQAKTYEENGAAMISVLTDEVFFKGDISYLKEISTQVAIPTLAKDFIIDEKQ
IVRSRNAGATVILLIVVALPEARLKELYDFATSLGLEVLVETHNLPELEVAHRIGAEIIG
VNNRNLVTFETDINTSLELSTHFKDKPVYISESAIFTGQDAALVAPYFNGILVGTALMTA
DNVAKKVKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcttttcttccaacaatcctagaacaaaaagaaaaagaagtggcccagttg
gtcatggaagacttacagcccttgcgtcagacctatcgcctttatgattttctcaagtca
aatcaaaacaagttgcaaattatttctgaagtgaagaaagccagtccaagtatgggtgat
attaacctagatgtggatattgtagctcaggccaagacctatgaggaaaatggggcagcc
atgatttcagttttgactgacgaagtcttcttcaaaggtgatatttcctatttgaaagaa
atttcgacacaggtagcgattccaaccttggctaaggacttcattattgatgagaaacag
attgtgcgtagccgtaatgcgggtgcgacagtcattctcttgattgtagtggccttgcca
gaagctcgtctcaaggagctctatgattttgcgactagccttggcttggaagtcttggtt
gaaacgcataatctgccagaattggaagtggctcaccgtattggtgctgaaattatcgga
gtaaacaaccgtaatttggtgacatttgagacagatatcaataccagtcttgagttatcg
acgcatttcaaggataaacctgtttatatttctgagtcggctatttttacaggtcaggat
gctgccctagttgccccatattttaatgggattctggtaggaactgcccttatgacggct
gacaatgtagctaaaaaggtcaaggagttgcaaattgacaaaggttaa

DBGET integrated database retrieval system