KEGG   Streptococcus thermophilus ND03: STND_1751Help
Entry
STND_1751         CDS       T01978                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:stn00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1654855..1656309)
Genome map
AA seq 484 aa AA seqDB search
MAKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFIIRIEDTDRKRHVEDGERSQL
DNLRWLGIDWDESPETHENYRQSERLPLYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFLGMTEEEKAAYIAEREAAGIIPTVRLAVNESGIYKWHDIVKGDIEFEG
GNIGGDWVIQKRDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLITNSETGKKLSKRDTNTLQFIEDYRKKGYLPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKLDWMSNDYIKHADFDKVFALCKPFLEEAGRLTDKAEK
LVELYKPQMTAAEEIVPLTDLFFEDFPELTAAEKEVMAGETVPTVLEAFKAKLEAMSDDE
FVTENIFSQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPETIFLLGREKSIKHIDQV
LATL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagatatccgcgttcgttacgcaccaagtccaacagggctgctacacattggt
aatgcccgtacggcattgtttaactacctctatgcacgtcatcatggcggtactttcatt
attcgtattgaagatactgaccgtaagcgtcacgttgaagatggtgagcgttcacagctt
gataacttgcgttggttgggaattgactgggatgaaagtcctgaaacacatgaaaattac
cgtcaatcagagcgtttgccactttaccaaaaatatattgatcaacttttggcagaaggt
aaggcttacaagtcatatgtaactgaagaagagttggctgcagaacgtgaacgtcaagaa
gcagcaggtgaaacacctcgttatattaacgagttccttggtatgactgaagaagaaaaa
gccgcctacatcgcagaacgtgaagccgctggcattattcctacagttcgtttggctgtt
aatgagtcaggaatctataaatggcatgatatcgttaaaggagatatcgaatttgaaggt
ggcaatatcggtggtgattgggttatccagaagagggatggttatccaacttacaacttt
gcggttgttgttgatgaccacgatatgcaaatttcacacgtgatccgtggagatgaccac
attgccaatacgccaaaacagcttatggtttatgaggctcttggttgggaagcgcctgag
tttgggcacatgacccttatcaccaattctgaaactggtaagaagttgtctaaacgtgat
actaatacccttcaatttatcgaagattaccgtaaaaaaggttacctgccagaagcagtc
ttcaactttattgctcttctaggttggaaccctggtggtgaggacgaaatcttctctcgc
gaagaacttatcaaactctttgatgaaaaccgtctaagtaagtctccagcggcctttgac
cagaagaaactggattggatgagtaatgactacatcaagcatgctgatttcgataaggtc
tttgctctttgcaaacccttcttggaagaagctggtcgtttgacagataaagctgaaaaa
ttagttgaactctataaaccacagatgacagctgcggaagaaattgtacctcttacagac
ctctttttcgaagatttcccagaattgacagcggctgaaaaagaagttatggctggtgaa
acagtaccaacagtacttgaggcctttaaagctaaacttgaagctatgtcagatgatgag
tttgttacagaaaatattttctcacaaattaaggctgttcaaaaagaaacaggaattaaa
gggaaaaacctcttcatgccaattcgtatagctgtttcaggagagatgcacggcccagaa
ttaccagagactatctttttacttggtcgtgaaaaatctattaaacatattgatcaagtt
ctcgcaacactataa

DBGET integrated database retrieval system