KEGG   Streptococcus thermophilus ND03: STND_1770Help
Entry
STND_1770         CDS       T01978                                 

Definition
Glucose-1-phosphate uridylyltransferase, putative
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STND_1770
   00052 Galactose metabolism
    STND_1770
   00500 Starch and sucrose metabolism
    STND_1770
   00520 Amino sugar and nucleotide sugar metabolism
    STND_1770
Enzymes [BR:stn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STND_1770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667328..1668242
Genome map
AA seq 304 aa AA seqDB search
MKNQKVRKAVIPAGGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTSINLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDITNDKAVPLTKQLINDYEETHASTIAVMPVSSEEVSAYGVIAP
QGKGENGRYSVETFVEKPNPEDAPSDLAIIGRYLLTPEIFGILENQEPGAGNEVQLTDAI
DTLNKTQRVFARVFTGDRYDVGDKFGFMKTSIDYALKHPQIKDDLKQYLIELGHKLEGKP
TKKG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaaagttagaaaagctgtcatccccgctggaggacttggaacacgcttt
ttaccagctactaaagcattggccaaagaaatgttgccaatcgttgacaaaccaaccatc
caatttatcgttgaagaagctcttaagtctggtattgaagatatcttggttgttaccggt
aaatcaaaacgctctatcgaagaccattttgactcaaacttcgaattagaatataacttg
gaacaaaaaggtaagactgacttgttgaaattggttaatgacaccacttctattaatctc
cactttatccgtcaaagtcacccacgtggtctcggagatgctgttctccaagccaaagca
tttgtcggaaatgaaccttttgttgtcatgcttggtgacgacctcatggatattactaac
gacaaagcggtacctttgactaaacaacttatcaacgattatgaggagacacatgcatct
actattgcggttatgcctgtgtcttctgaagaagtctctgcttatggtgtaatcgctcct
cagggtaaaggcgaaaatggacgttacagcgttgaaactttcgttgaaaaaccaaatcca
gaagatgcaccgagtgatcttgctatcatcggacgttaccttttaacacctgagattttc
ggtatcttagaaaatcaagaaccaggtgctgggaatgaagtccaattgactgatgctatc
gatactcttaacaaaacacaacgcgtctttgctcgtgtatttacaggagatcgttatgat
gtcggtgacaaatttggctttatgaagacgtctattgattacgcacttaaacaccctcaa
attaaagatgaccttaagcaataccttattgaattgggccacaaacttgaaggcaaaccc
actaaaaaaggctaa

DBGET integrated database retrieval system